авторефераты диссертаций БЕСПЛАТНАЯ  БИБЛИОТЕКА

АВТОРЕФЕРАТЫ КАНДИДАТСКИХ, ДОКТОРСКИХ ДИССЕРТАЦИЙ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ

Новые тиоловые оксидоредуктазы систем тиоредоксина и глутаредоксина. их роль в регуляции окислительно восстановительного баланса клетки

На правах рукописи

НОВОСЁЛОВ Сергей Владимирович Новые тиоловые оксидоредуктазы систем тиоредоксина и глутаредоксина. Их роль в регуляции окислительно восстановительного баланса клетки 03.00.04 – биохимия 03.00.03 – молекулярная биология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора биологических наук

Пущино, 2008 1

Работа выполнена в Институте биофизики клетки РАН, Пущино и в Университете Небраски в Линкольне (UNL), Департамент биохимии, Линкольн, Небраска, США

Официальные оппоненты: доктор биологических наук, профессор О.Н. Озолинь доктор биологических наук, профессор В.З. Ланкин доктор биологических наук, И.П. Белецкий

Ведущая организация: Институт биоорганической химии РАН им.

акад. М.М. Шемякина и Ю.А. Овчинникова

Защита диссертации состоится « 23 »октября 2008 г. в 1400 ч.

на заседании Диссертационного совета Д 002.038.01 в Институте биофизики клетки РАН по адресу: 142290, Пущино, Московская область, ул. Институтская

С диссертацией можно ознакомиться в Центральной библиотеке Пущинского научного центра РАН

Автореферат разослан «23 » сентября 2008г.

Ученый секретарь диссертационного совета кандидат биологических наук Т.И. Смолихина ОБЩ АЯ ХАРАКТЕРИСТИКА РАБОТЫ Актуальность проблемы Важная роль свободных радикалов и активных форм кислорода в процессах жизнедеятельности клеток в норме, а также при патологиях в настоящее время не вызывает сомнений. Это подтверждается и тем обстоятельством, что количество оригинальных работ, опубликованных в мировой биомедицинской литературе по этой проблеме, исчисляется сотнями тысяч. Нарушение внутриклеточных процессов окисления-восстановления часто является одной из причин или сопровождает развитие таких распространённых патологий, как диабет, нейро дегенеративные, бронхо-лёгочные и онкологические заболевания, инфаркт миокарда и т.д. Таким образом, выяснение молекулярных механизмов действия систем, сопряженных со свободными радикалами, необходимо не только для понимания фундаментальных основ физиологии клетки, но и потенциально имеет колосальное практическое приложение, поскольку терапевтическое воздействие на те или иные компоненты системы окисления-восстановления теоретически может давать возможность корректировать патологические состояния. К середине 70-х годов биомедицинские иследования, объединившие биохимические, молекулярные и медицинские подходы к изучению свободных радикалов оформились в самостоятельное научное направление – редокс биология.

Клеточный метаболизм перекисных соединений необыкновенно сложен и включает в себя целый ряд систем, состоящих как из низкомолекулярных продуктов, так и из макромолекул. Ферменты, называемые пероксидазами, представляют из себя гетерогенную группу многи х белковых семейств, работающих по различным каталитическим принципам и выполняющи х широкий спектр биологических функций, из которых детокси фи кация перекиси водорода, или классичесая «антиоксидантная» функция, является лишь одной из многих.

H2O2-зависимый синтез вторичных метаболитов среди гем-содержащих пероксидаз и родственных ферментов осуществляется транзиторным катализом с участием металлов, который часто сопровождается образованием других свободных радикалов.

Другой класс ферментов-антиоксидантов, включающий кофермент независимые глутатион пероксидазы и пероксиредоксины, катализируют дву электронный перенос восстановительного эквивалента, и, таким образом, нейтрализуют перекись водорода без образования свободных ради калов, появление которы х само по себе может наносить вред клетке. Однако, в дополнение к антиоксидантным эффектам, у эти х тиоловых оксидоредуктаз есть способность к утилизации гидропероксида для образования специфичных дисульфидных связей внутри или между белками (Рис.1), что существенно расширяет спектр их функциональных возможностей, включающих окислительно-восстановительную регуляцию метаболических процессов, сигнализацию и т.д. Между тем, до настоящего времени не было проведено достаточно широкого исследования тиоловых оксидоредуктаз, более того, многие белки этого суперсемейства не были идентифицированы. Полагаем, что идентифи кация новых тиоловых оксидорелуктаз и выяснение механизмов их функционирования в живых организмах является весьма актуальной фундаментальной проблемой редокс биологии.

Рисунок 1. Схема, иллюс трирующ ая метаболизм перекиси водорода и основные ферменты, в ов леченные в э тот процесс. Обозначения: КАТ – к аталаза, GSH – восстановленный г лу татион, GSSG – окис ленный г лутатион, GPx –- г лутатион пероксидаза, Prx – пероксиред оксин, GR – г лутатион редук таза, TR – тиоредоксин редуктаза, Trx – тиоредоксин, Grx – глу таредоксин, RSSR – окис ленный субстрат, RS H – в осстанов ленный субстрат.

Цель и задачи исследования:

В соответствии с поставленной проблемой, направленной на идентификацию неизвестных ранее тиоловых оксидорелуктаз и выяснение механизмов их функционирования в живых системах, были определены следующие задачи :

1. Проанализировать эволюцию тиоредоксин редуктаз для выяснения физологической значимости и причин существования их «коротких» и «длинных» форм.

2. Иденти фицировать и охарактеризовать недостающий митохондриальный компонент системы глутаредоксина.

3. Выяснить структурные и функциональные характеристики тиоредоксин глутатион редуктазы млекопитающих.

4. Провести поиск новых селен-содержащих оксидоредуктаз у разных видов животных.

5. Найти закономерности в структуре и биохимических характеристиках этих новых ферментов и классифицировать их.

Научная новизна. Новизна представленных в работе результатов определяется несколькими обстоятельствами. Во-первых, на основании филогенетического анализа впервые было установлено, что «большая» форма тиоредоксин редуктазы произошла от GR низших эукариот путём удлинения карбокситерминального конца белка с появлением Gly-SecCys-Cys-Gly мотива в новом каталитическом окислительно-восстановительном центре, который фун кционально заменил глутатион в качестве транзиторного субстрата для этого фермента. Во-вторых, впервые был идентифицирован и охарактеризован новый митохондриальный глутаредоксин (Grx2). На основании кинетических данных было доказано, что белок Grx2 обладает наиболее высоким сродством по отношению к L-цистеину, и это сродство было эквивалентно таковому для HEDS и S-сульфоцистеина. В третьих, было доказано, что TGR структурно является тиоредоксин-глутатион редуктазой, обладающей тиолтрансферазной, глутатион и тиоредоксин редуктазной, и протеин дисульфид изомеразной активностью in vitro, а функционально – это изомераза Gpx4, вовлечённая в образование митохондриальной капсулы сперматозоидов. В-четвертых, был иденти фицирован и охарактеризован новый селен-содержащий белок SelM, имеющий новый тип SECIS элемента. На основании анализа генома человека было выявлено 25 селен содержащих белка, семь из которых ранее не были известны. Среди них имеются:

новая глутатион пероксидаза Gpx6, экспрессирующаяся в обонятельном эпителии на определённых стадиях эмбриогенеза, а также SelV – белок сперматоцитов. В пятых, было доказано, что SelH - это новая тиоловая оксидоредуктаза ядрышек, имеющая необычный паттерн экспрессии. И, наконец, обнаружили новую тиоловую оксидоредуктазу эукариот, названную нами Rdx12. На основании компъютерного анализа объединили Rdx12, SelW, SelV, SelT и SelН в новое семейство тиоловых оксидоредуктаз с тиоредоксин-подобной укладкой. Это новое семейство белков было охарактеризовано и названо нами Rdx.

Аробация работы. Материалы диссертации были представлены на нескольких симпозиумах и конференциях: 8th International Symposium on Se lenium in Biology and Medic ine, (2006) Мадисон, США;

Experimental Biology 2004 (EB 2004) Бостон, США;

Experimental Biology 2003 (EB 2003) Сан Диего, США;

Experimenta l Biology 2002 (EB2002) Новый Орлеан, США;

17th Joint Meeting of the International Society for Neurochemistry (ISN) and the 13th General Meeting European Society for Neurochemistry (ESN), 1999, Берлин, ФРГ.

Структура и объем диссертации. Диссертация изложена на 170 страницах машинописного текста, содержит 40 рисунков и 5 таблиц. Список работ, опубликованных по теме диссертации, содержит 29 статей в реферируемых журналах, глав у в сборнике и заяв ку на Патентное разрешение.

СОДЕРЖАНИЕ РАБОТЫ

Глава 1. Белки, непосредственно вовлечённые в Trx и Grx системы.

При исследовании окислительного стресса было выявлено ключевое значение NADPH-зависимых тиоредоксин- и глутаредоксин систем. В системе тиоредоксина (Рис.2) восстановительный эквивалент (поток электронов), противодействующий окислительному стрессу, протекает в следующем направлении: NADPH Тиоредоксин Редуктаза Тиоредоксин Тиоредоксин Пероксидаза перекись водорода. Таким образом, первая и наиболее изученная фун кция этой системы направлена на разрушение перекисных соединений, прежде всего перекиси водорода, с использованием тиоредоксина и NADPH.

Кроме того, тиоредоксин сам способен взаимодействовать по редокс типу с цистеинами ряда клеточных белков, таки х как сигнальные белки (например киназы-фосфотазы), факторы транскрипции, рибонуклеотид редуктаза и антиоксидантные белки (например метионин сульфоксид редуктазы и пероксиредоксины).

Рисунок 2. Сис тема тиоред оксина Подобный поток восстановительного эквивалента характерен и для системы глутаредоксина: NADPH глутатион редуктаза глутатион (GSH) глутатион пероксидаза перекись водорода или NADPH глутатион редуктаза глутатион (GSH) глутаредоксин смешанные дисульфидные связи в белках (Рис. 3). Глутаредоксин, будучи структурным и функциональным гомологом тиоредоксина, также может взаимодействовать с другими белковыми молекулами, такими как рибонуклеотид редуктазы, пероксиредоксинами или более простыми молекулами, вовлечёнными в редокс процессы, например с витамином С.

Рисунок 3. Сис тема г лутаредоксина Таким образом, наряду со способностью защи щать клетку от воздействия как эндогенных, так и экзогенных активных форм кислорода (АФК), повреждающих ДНК, белки и липиды, что необходимо для поддержания нормальной жизнедеятельности, системы тиоредоксина и глутаредоксина играют фундаментальн ую роль в регуляции внутриклеточных процессов посредством поддержания корректного тиолового гомеостаза, белок-белковых взаимодействий, влекущих за собой пострансляционные модификации, и/или конформационные изменения целого ряда ключевых сигнальных белков.

Тиоредоксин редуктазы.

Как уже было отмечено, тиоредоксин редуктаза и тиоредоксин являются основной окислительно-восстановительной системой, присутствующей во всех организмах. Однако, в отличие от только одной формы тиоредоксина, существуют два типа тиоредоксин редуктаз: бактериального типа или «малая» (Small TR), характерная для бактерий, архей, растений и многих одноклеточных эукариот, и вторая - TR животных или «большая» (Large TR), обнаруженная только у животных и обычно содержащая С-концевой селеноцистеин в составе Gly-SecCys Cyc-Gly мотива.

Для изучения распространнённости этих двух форм тиоредоксин редуктазы в геномах различных организмов были использованы Nonredundant, EST и геномные микробные базы данных NCBI, а также программа TBLAST для поиска гомологов человеческих TR. Мы обнаружили «большие» формы тиоредоксин редуктаз в одноклеточных организмах последовательности:

(EST Tetrahymena BM395971,BM395814, BM395972), Toxoplasma (EST последовательности:

BI997644, BG852257, BG852256, BG852259) и Chlamydomonas, при этом в геномах бактерий этих больших форм обнаружено не было. Поскольку Chlamydomonas относится к растениям, мы проанализировали EST базу данных этого организма на наличие «малых» форм тиоредоксин редуктазы и обнаружили три таки х белка (первый: BF863161, AV633771, AV624607;

второй: AV387919, AW758306, BE122071, AV628812;

и третий: AV628023, AV631626, AV628019, AV629759).

Таким образом, мы нашли, что Chlamydomonas содержит как «малую», так и «большую» форму TR. Это позволило предположить, что либо длинные формы TR возникли в эволюционном развитии на достаточно ранних этапах, например, когда возникли эукариоты, либо они были перенесены в некоторые низшие эукариоты из животных путём горизонтального переноса генов. Чтобы различить эти два сценария, на первом этапе был проведён филогенетический анализ белков семейства пиридин динуклеотид оксидоредуктаз (Рис. 4). Общая композиция филогенетического дерева подтвердила независимое происхождение «малых» и «больших» форм, поскольку последние кластеризовались с липоамид дегидрогеназами (LADH), ртуть ион редуктазами (MerA) и глутатион редуктазами (GR), тогда как «малые» формы сформировали отдельную группу, и при этом короткие формы бактерий и архей кластеризовались отдельно от низших эукариот.

Примечательно, что «большие» TR сформировали группу с глутатион редуктазами эукариот, что указывает на их расхождение на уровне появления низших эукариот.

Чтобы исключить сценарий, при котором большие TR появились у низших эукариот благодаря горизонтальному переносу генов, мы проанализировали возможность того, что другие гены высших эукариот также присутств уют в организмах эти х низших эукариот, содержащих большую форму TR. Для этого мы использовали все доступные на тот момент белковые последовательности Chlamydomonas из SWISS-PROT и TrEMBL баз данных (608 последовательностей) и сконструировали филогенетические деревья для всех этих белков. Как и предполагалось, большинство из них кластеризовалось с последовательностями белков растений, однако мы обнаружили 12 последовательностей, которые кластеризовались с белками животных. Все эти белки являлись вовлеченными в образование жгути ков у Chlamydomonas, однако, для них не было найдено соответствующих ортологов у растений, что не дало возможности достоверно выявить филогенетическое родство. Таким образом, мы не обнаружили примеров горизонтального трансфера генов и заключили, что «большая» форма TR развилась независимо.

.

Рисунок 4. Ф илогенетич еское дерево пирид ин динук леотид оксидоредуктаз.

На основании полученных данных мы пришли к следующим выводам:

«большая» форма тиоредоксин редуктазы животных эволюционно произошла на уровне низших эукариот значительно раньше, чем «малая» форма TR была потеряна в организмах, от которы х произошли животные. Обе эти формы сосуществовали в процессе эволюции, и мы идентифицировали организм (Chlamydomonas reihardti), который содержит оба фермента. Среди высших эукариот «большая» форма стала преобладать у животных, тогда как «малая» сохранилась в растениях и грибах. «Большая» форма TR произошла от GR низших эукариот путём удлинения карбокситерминального конца белка с появлением Gly SecCys-Cyc-Gly редокс мотива в новом каталитическом окислительно восстановительном центре, который функционально заменил глутатион в качестве транзиторного субстрата для этого фермента (Рис.5).

Таким образом, мы предположили возможный эволюционный механизм, по которому могут появляться новые функции в белках. За очень небольшим исключением, С-концевая часть ферментов редко бывает консеративной и вовлеченной в активные центры. Случайное (например в результате мутации стоп кодона) удлинение карбокси-терминальной части может приводить к появлению последовательности, взаимодействующей (или модулирущей взаимодействие) с N концевыми структурами, как показано для «больши х» форм TR, что влечёт за собой модифи кацию функции, её «улучшение» или даже появление новой биохимической активности.

Глутатион восстановленный GSH S Se H Тио e S ре доксин SH ок.

SH S S S S Тио ре доксин восст. FAD NADP+ FAD NADP+ SH SH S S e e- e FAD NADP+ NADPH FAD NADPH NADPH FAD FAD e- e- e SH SH e SH SH SH SH - Se S e e SS S S Тио Ре доксин ок. Глутатион окисленный GSSG Рисунок 5. Пред ложенный механизм эволюции белков ых молекул пу тём удлинения С концевой его час ти на примере тиоредоксин и г лутатион редуктаз.

Идентификация нового глутаредоксина (тиолтрансферазы) млекопитающих (GRx2).

Семейство тиоредоксинов и семейство глутаредоксинов объединены в суперсемейство тиоловых оксидоредуктаз, содержащи х тиоредоксин-подобную складку, которое включает также пероксиредоксины, протеин – дисульфид изомеразы, глутатион пероксидазы, трансферазы и ряд других белков.

По структурным параметрам – это глобулярные белки с характерной тиоредоксин-подобной укладкой (1-1-2-2-3-4-3) и консервативным СХХС мотивом (где С – цистеин и Х – любая аминокислота), входящим в каталитический центр (Рис. 6А и 6Б). Этот каталитический центр находится в частично экспонированной петле или кармане между C-концевой альфа1 спиралью и N-концевым бета2 слоем. В зависимости от того, какие аминокислоты разделяют консервативные цистеины в СХХС мотиве, и каково редокс окружение (например, цитоплазматическое «восстановительное» или «окислительное», как в эндоплазматическом ретикулуме), эти ферменты могут быть или восстановителями (например, тиоредоксины и пероксиредоксины), или окислителями, как протеин дисульфид изомеразы. Кроме того, было показано, что альфа спираль, следующая за СХХС мотивом, влияет на способность к ионизации консервативных цистеинов таким образом, что N-концевой цистеин имеет пониженный рКа в сравнении со свободным цистеином.

A Б В Тиоредоксины, Глутатион Пероксиредоксины, Глутаредоксины, пероксидазы, CxxC мотив TxxC мотив СxxC/S мотив С/SecxxT мотив Рисунок 6. Структура тиоредоксина и тиоловых оксидоредуктаз с тиоредоксин подобной укладкой А. Глобулярная с трук тура тиоредоксина человек а (hTrx1), спирали обозначены красным, -с лои - жёлтым. (Forman-Kay JD, Clore GM, Wingfield P T, Gronenborn AM.

High-resolution three-dimensional structure of reduced recom binant human thioredoxin in solution, PDB ID 1E RT).

Б. Схема, предс тавляющая структуру тиоредоксина и тиоред оксин-подобной укладки (фолда), -спирали обознач ены красным, -с лои - жёлтым. Положение консерв атив ных цистеинов CXXC мотива обозначено зелёным цветом. Тиоредоксин подобная укладка (фолд) (1122343) показана синим цв етом.

В. Каталитич еский центр некоторых тиолов ых оксидоредуктаз тиоредоксин-подобной укладки. Примеч ательно, что у глу таредоксинов C-концевой цис теин может быть заменён на серин (Ser), а у глутатион пероксидаз N-концев ой цистеин - на селеноцис теин (S ec).

Для системы тиоредоксина млекопитающих, состоящей из тиоредоксин редуктазы, тиоредоксина и тиоредоксин пероксидаз было показано наличие как цитоплазматических, так и митохондриальных её компонентов, кодируемых различными генами (цитоплазматические тиоредоксин редуктаза (TR1), тиореодоксин (Trx1), и, соответственно, митохондриальные TR3 и Trx2).

Напротив, в случае системы глутаредоксина млекопитающих, только её цитоплазматические формы были хорошо изучены. Однако, для глутатион редуктазы мы ши и человека было показано наличие её митохондриальных изоформ, образующи хся в результате альтернативного сплайсинга единственного гена GR. Кроме того, как минимум для двух глутатион пероксидаз (GPx1 и GPx4) были охарактеризованы их митохондриальные изоформы. Более того, было показано, что порядка 10% общего клеточного глутатиона приходится на митохондрии. Очевидна также необходимость поддержания оптимального окислительного-восстановительного баланса в этих клеточных органеллах. Таким образом, было бы логично предположить, что недостающий компонент – митохондриальный глуторедоксин – должен присутствовать в этих структурах.

Глутаредоксины – это небольшие (10-14 кДа) белки с характерным CXXC мотивом (обычно Cys-Pro-Tyr-Cys) в N-коцевом участке молекулы и консервативным глутатион-связывающим доменом в C-концевой части. Цистеины каталитического центра СХХС служат донорами электронов, образуя обратимые дисульфидные связи с молекулами субстрата с последующим их восстановлением глутатионом.

В момент проведения данной работы ни один из геномов млекопитающих не был расши фрован, поэтому компьютерный анализ методом поисков гомологов проводился против EST баз данных млекопитающи х. Используя известные последовательности Grx, мы обнаружили несколько гомологичных, но неописанных ранее последовательностей в базе данных EST человека, содержащие последовательность, кодирующую открытую рамку считывания (ORF) белковой последовательности длиной 164 аминокислот. Используя эту последовательность для поиска гомологии, мы нашли, что такая последовательность также кодируется у мы ши, крысы и свиньи, что указывает на её консервативность среди млекопитающих.

В наших экспериментах н уклеотидная последовательность была подтверждена методом сиквенирования, и этот новый сиквенс показал 36% идентичности с известным человеческим глутаредоксином (Grx1) и был назван нами Grx2. Множественное выравнивание (Multiple alignment) обнаруженных новых последовательностей с известными Grx1 показало, что GRx2 белки имеют консервативный дисульфидный каталитический центр и консервативный GSH связывающий участок.

Дальнейшее исследование Grx2 последовательностей с помощью программ SignalP и PSORT показало наличие возможного митохондриального сигнала, представляющего из себя гидрофобн ую последовательность с высоким содержанием лизинов и аргининов, формирующи х альфа-спираль. Для того, чтобы проверить это компьютерное предсказание, мы экспрессировали ряд химерных Grx2-GFP белков в клеточной линии NIH 3T3 c последующей визуализацией GFP флуоресценции с помощью кон фокальной микроскопии (Рис. 7).

Когда N-концевой сигнальный пептид или полноразмерный Grx2 был объединён с GFP, флуоресценция наблюдалась в митохондриях, а Grx2-GFP последовательность с отсутствующим N-концевым сигналом не показала какой либо специфичной внутриклеточной локализации. Таким образом, компьютерные предсказания топологии Grx2 белка были подтверждены, и было доказано, что белок является митохондриальным.

Рисунок 7. Исследов ание локализации Grx2 в клетк е. Слева схематично показаны химеры реком бинатных форм Grx2 с зелёным флу оресцентным белком, использованные для транс фекций в клеточ ной линии NIH 3T3. Справа – на централь ной панели показано окрашив ание митохонд риальным маркером MitoTracker.

Для биохимического анализа нового человеческого глутаредоксина, рекомбинантный Grx2 был экспрессированы в E.Coli с полигиститдиновым N концевым кластером для последующей аффинной очистки на никель-агарозе.

Полученный рекомбинантный Grx2 был использован для сравнения в стандартных реакциях, параллельно с рекомбинантным Grx1 человека.

Рекомбинантный человеческий Grx2 катализировал восстановление смешанных дисульфидны х связей, сформированных между GSH и HEDS, S сульфоцистеином или L-цистеином. При этом Km значения составляли 1.68, 1.77 и 0.30 mM соответственно. Каталитическая эффективность (kcat/km) была различной для этих трёх субстратов. Таким образом, белок Grx2 обладает наиболее высоким сродством по отношению к L-цистеину, и это сродство было эквивалентно таковому для HEDS и S-сульфоцистеина.

Тиоредоксин-Глутатион редуктазы.

Тиоредоксин-Глутатион редуктаза (TGR) – недавно обнаруженный фермент семейства тиоредоксин редуктаз. В отличие от двух других тиоредоксин редуктаз млекопитающих, он содержит N-концевой глутаредоксиновый домен (Рис. 8) и имеет очень широкий спетр биохимических активностей in vitro. Для выяснения реакционного механизма и регуляции данного фермента мы получили полноразмерную рекомбинантную мы шиную TGR, а также ряд её мутантных форм и индивидуальных доменов.

Рисунок 8. Схема с троения «малых» и «больших» TR, GR и TGR.

.

Мы показали, что TGR структурно является тиоредоксин-глутатион редуктазой, биохимически обладает тиолтрансферазной, глутатион и тиоредоксин редуктазной и протеин дисульфид изомеразной активностью.

Столь широкий спектр биохимических активностей был ожидаем и не давал ответа на вопрос о физиологической роли данного белка. Посколку мы показали, что основная часть TGR экспрессирована в тестикулах млекопитающих, эти антитела были использованы в иммуногистохимических реакциях с тестикулами мы ши на световом и электроннно-микроскопическом уровне (Рис.9).

Мы показали, что TGR локализован в перемитохондриальном пространстве сперматоцитов определённых стадий развития. Известно, что митохондрии являются основным местом локализации Gpx4, поэтому мы использовали этот белок в реакции изомеризации с TGR и показали, фун кционально Тиоредоксин Глутатион редуктаза является изомеразой Gpx4, вовлечённой в образование митохондриальной капсулы сперматозоидов.

Рисунок 9. Иммуног истохимич еское исследов ание локализации TGR. А. Световая микроскопия. Б. Элек тронная микроскопия.

Глава 2. Новые селен-содержащие белки.

Особенностью катализа селен-содержащих оксидоредуктаз является наличие селеноцистеина вместо цистеина в каталитическом центре. Селен и сера, будучи халькогенами, являются неполными электронными аналогами. Таким образом, цистеин и селеноцистеин, в какой-то степени похожи, с той разницей, что рКа свободного цистеина при нормальном рН составляет 8.18, а селеноцистеина - 5.73, поэтому селеноцистеин обладает намного более высокой реакционной активностью.

С точки зрения молекулярной биологии селеноцистеин представляет собой исключительный интерес. Являясь 21-ой природной встречаемой в белках аминокислотой, он кодируется TGA кодоном, обычно служащим сигналом терминации трансляции. Ряд цис и транс-факторов вовлечены в биосинтез селен содержащих белков (Рисунок 9). К цис-факторам, наряду с TGA кодоном, относится SECIS элемент (SECIS: selenocysteine insertion sequence) – структура, находящаяся в 3’ нетранслированной области селенопротеиновой мРНК эукариот или немедленно за TGA кодоном у прокариот. К транс-факторам относятся Sec тРНК (отмечена красным на рисунке 10), Sec-специфичный фактор эллонгации EFsec и SBP2 (SECIS-связывающий белок-2, отмечен зелёным).

Рисунок 10. А - схема, показывающ ая м еханизм встраив ания селеноцис теина в белки;

Б – структура SECIS элем ента. (Hat field DL, Gladyshev VN, How selenium has altered our understanding of the genetic code, Mol Cell Biol. 2002.;

22(11):3565-76.) В последние годы с развитием технологий определения нуклеотидных последовательностей количество информации в биологических базах данных нарастает с очень большой скоростью. Анализ этих баз данных позволяет идентифицировать новые, ранее неизвестные гены, кодирующие, в частности, тиоловые оксидоредуктазы. Изучение этих новых оксидоредуктаз, а именно их биохимическое исследование, поиск белков-мишеней, изучение механизмов регуляции и экспрессии на клеточном и тканевом уровнях очень важно для более глубокого понимания фундаментальных проблем редокс биологии.

Поиск новых селено-содержащи х оксидоредуктаз представляется сложным из-за того, что при автоматическом компьютерном анотировании расши фрованных геномов TGA кодоны узнаются соответствующими программами как стоп кодоны, что приводит к их ошибочному анотированию.

Новый селен-содержащий белок Sel M.

Одним из способов идентификации новых селен-содержащи х белков является поиск гомологов уже известных белков. Используя этот метод, с помощью программ PSI-BLAST/PHI-BLAST, мы обнаружили кДНК последовательность длиной 0.7-kb, гомологичную последовательности ранее охарактеризованного белка Sep15 в EST базе данных млекопитающи х, и назвали этот белок SelM. кДНК последовательности из базы данных мы шиного и человеческого SelM были подтверждены методом сиквенирования. Открытая рамка считывания содержала 148 аминокислот и предсказанный селеноцистеин, кодируемый TGA кодоном, находился в положении 48. Гомологичные белки были также обнаружены нами у крысы, рыбы (Zebra fish) и у ряда других позвоночных. Эти белки имели примерно 50% идентичности, и селеноцистеин в этих гомологах был абсолютно консервативен.

Дальнейший анализ нуклеотидной последовательности 3’ нетранслированной области мРНК SelM показал, что в апикальной петле вместо абсолютно консервативных аденозинов находятся цитозины. Для доказательства того, что данный белок действительно является селен-содержащим, мы использовали ранее предложенный метод, суть которого заключается в транзиторной экспрессии химерного GFP-Sel белка методом трансфекции клеток млекопитающих с одновременным метаболическим мечением этих клеток радиоактивным изотопом селена Se75 и последующей визуализацией радиоавтографа белков, разделённых в ПААГ-электрофорезе. В данных условиях в случае, если селен встраивается в полипептидную цепь химерного белка, на радиоавтографе в дополнение к полосам, соответствующим эндогенным селен-содержащим белкам, появляется дополнительная полоса предсказанного размера (Рис. 12).

А Б Рисунок 11. А – схема, иллюс трирующая структуру использу емых хим ер SelM. Б вторич ная струк тура му тантных вариантов SECIS элем ентов, использу емых в экспериментах.

Мы приготовили следующий набор химерных конструкций мышиного SelM с GFP: GFP- мSelM ди кого типа, GFP- мSelM(Sec TGATGT) (седеноцистеиновый кодон TGA заменён на TGT), GFP- мSelM(TGA корня SECIS элемента TGAATC)(TGA триплет в SECIS элементе мутирован на ACT для предотвращения встраивания селеноцистеина), GFP- мSelM(CC)(цитозины апикальной петли в положении 576 и 568 были удалены), GFP- мSelM(CCAA)( цитозины в положении 576 и 568 были мутированы на аденозины), GFP мSelM(CCGG)(цитозины в в положении 576 и 568 были заменены на гуанозины), GFP- мSelM(CCTT)(цитозины заменены на тимидины) и, наконец, химеру, в которой мы шиная апикальная петля была заменена на человеческую (Рис. 11 Б).

Мы трансфецировали CV-1 клети с этими конструкциями одновременно с радиоактивным мечением, и на радиоавтографах ПААГ гелей выявили дополнительную полосу размером 44 кДа для химеры GFP с диким типом SelM, когда цитозины были заменены на аденины, а мышиная апикальная петля была замена на человеческую. Таким образом, были сделаны следующие выводы: SelM действительно является новым селен-содержащим белком и новая форма SECIS элемента, в которой ранее считавшиеся абсолютно консервативными аденозины могут быть замены на цитозины, явлется функциональной.

Рисунок 12. Метаболическое мечение с Se CV1 клеток, транс фецированных с указанными конструкциями.

1-GFP - мSelM дикого типа 2- GFP - мSelM(CCAA)( цитозины в в положении 576 и 568 были му тиров аны на аденозины) 3 - GFP- мSelM(Sec TGATGT) (селеноцис теиновый кодон TGA заменён на TGT) 4 -GFP- мSelM(TGA корня SECIS элемента TGAATC)(TGA триплет в корне SECIS элемента му тирован на ACT для предотвращения встаив ания селеноцистеина) 5 - GFP- мSelM (мышиная апик аль ная петля зам енена человеческую) 6 -GFP- мS elM( CC)(цитозины апикаль ной петли в положении 576 и 568 были удалены), 7 – GFP- мSelM(CCTT)(цитозины заменены на тимидины) 8 - GFP- мSelM(CCGG)(цитозины в в положении 576 и 568 были зам енены на гуанозины) На следующем этапе была изучена экспрессия SelM мРНК в различных тканях методом Норзерн блоттинга. Мы показали, что SelM мРНК присутствует во многих тканях, а максимальный уровень экспрессии наблюдается в головном мозге (Рис.13).

SelM мРНК в тк анях мыш и.

Рисунок 13. Экспрессия Селенопротеом млекопитающих Ранее при расшифровке генома человека многие селен-содержащие белки были потеряны в процессе автоматической анотации с использованием стандартных программ из-за присутствия TGA кодонов внутри открытой рамки считывания. Поскольку селен играет очень важную роль и его эффекты обусловлены селенопротеинами, было необходимо идентифицировать и охарактеризовать все селен-содержащие белки.

В отличие от других исследователей, мы использовали следующий алгоритм для идентификации: 1) провели поиск всех теоретически возможных кандидатов SECIS с помощью программы SECISSearch 2.0 в геноме. Эта програма анализирует структурные и термодинамические признаки SECIS элементов. 2) Поскольку между SECIS элементами ортологов существует детектируемая гомология, мы идентифицировали далее все возможные человек/мышь и человек/крыса SECIS пары с помощью програмы SECISblastn, которая анализирует консервативность возможных SECIS элементов. 3) Проанализировали последовательности, находящиеся перед предполагаемым SECIS элементом программой geneid, которая позволила обнаруживать открытые рамки считывания c высоким кодирующим потенциалом и которые предположительно содержат TGA кодоны внутри этих рамок. 4) Наконец, предсказанные кандидаты были проанализированы по MSGS signature) критериям, что позволило (mammalian selenoprotein gene проскринировать селен-содержащие гомологи на наличие и консервативность открытых рамок считывания, содержащих TGA кодоны и SECIS элементы.

Первоначально (ATGA_AA_GA) паттерн был использован программой SECISSearch 2.0, что позволило идентифицировать 7146 возможных кандидатов на SECIS элемент. Далее программа SECISblastn обнаружила 1031 пару человек/мы шь и 276 пару человек/крыса среди найденных на первом этапе кандидатов. Далее, отфильтровав повторяющиеся последовательности в геномах мыши и крысы, мы нашли 56 уникальных человек/мы шь и 58 человек/крыса пар, из которых 40 были общими для всех 3-х организмов. Последующий анализ набора этих пар с помощью geneid программы и критериев MSGS уменьшил количество кандидатов до 20-ти. Среди них было 15 уже известных селеновых белков, а 5 - были новыми, которые мы назвали соответственно SelH, SelI, SelK, SelS и SelV.

Аналогичный компъютерный анализ с использованием ATGA_CC_GA паттерна позволил обнаружить SelM белок и ещё один новый, названный SelO.

Только два из известных генов селен-содержащих белков не были идентифицированы – SPS2 (селено-фосфат синтетаза), ген которой отсутствовал в базе данных, и тиоредоксин редуктаза 2, в которой в аденозин перед корнем SECIS элемента заменён на тимидин.

Далее эти 24 селеновых белка были проанализированы на наличие гомологов, и этот анализ позволил обнаружить 25-й селен-содержащий белок человека, названный глутатион-пероксидазой 6 (GPx6). Этот белок не был найден в SECISsearch анализе, поскольку его мы шиный и крысиный ортологи имели цистеин на месте селеноцистеина и не содержали SECIS элемента.

Для экспериментального подтверждения того, что найденные генетические последовательности действительно являются кодирующими для селен-содержащих белков, был использован тот же метод, что описан выше для SelM - трансфекции с конструкцией GFP-селен-содержащий белок химеры клеток млекопитающи х и мечения с Se75. Мы клонировали SelH, SelK, SelO, SelV и SelS в pEGFP-C3 вектор и трансфецировали с полученными конструкциями CV-1 клетки, пометив их радиоактивным изотопом селена (Рис.14).

.

Рисунок 14. Клетк и CV-1, транс фецированные и меч енные радиоак тив ным изотопом Se Кроме того, мы использовали поликлональные антитела для экспериментов по иммунопреципитации метаболически меченых селеновых белков и технологию А HeLa HEK Control Control MsrB Sep MsrB SelW Sep SPS Gpx SelW Gpx TR TR1/TR SPS GPx SelS GPx SelT SelH/SelM Sep15/MsrB SelW MsrB Б Рисунок 15. А – РНК интерференция некоторых матричных РНК, колирующ их селенов ые белки, выяв ленные методом м ечения радиоактив ным изотопом белкового продук та соответс твующего гена. Названия генов указаны на рисунке. Б – Левая панель – индив идуаль ный, двойной и тройной нокдаун GPx 1, GPx 4 и SelS в HEK 293 клетках.

Правая панель – иммунопреципитация м еченых селен-содержащих белков с соответс твующими поликлональным и антителами.

РНК интерференции для того, чтобы выяснить соответствие эндогенных селеновых белков специфичным полосам на радиоавтографах (Рис. 15).

Глутатион пероксидаза 6 (GPx6).

Глутатион пероксидаза 6 является гомологом ранее охарактеризованных белков этого семейства. Как уже отмечалось, это единственный пример среди млекопитающих, когда внутри этой таксонометрической группы среди ортологов селеноцистеин в каталитическом центре человеческого белка заменён на цистеин у грызунов.

Крысиная глутатион пероксидаза 6 была ранее клонирована и названа запах метаболизирующий белок, поскольку согласно результатам in situ гибридизации она была локализована в Боуменовых железах, где синтезируются и секретируются многие компоненты обонятельной слизи.

Мы клонировали Gpx6 мыши и свиньи, и провели Норзерн блот анализ, при этом используя Gpx3 в качестве контроля (Рис. 16). Показали, что матричная РНК Gpx экспрессируется не только в обонятельном эпителии, но и в эмбрионах мышей на ранних этапах эмбрионального развития. Таким образом, доказано, что этот белок играет определённую роль в эмбриогенезе.

Рисунок 16. Норзен блот анализ различ ных тканей м ыши и свинь и.

Gpx6 в эмбриональные процессы делает его Вовлеченнос ть белка исключительно важным, поскольку роль пищевых добавок селена в диетах для эмбриогенеза в настоящее время доказано для целого ряда животных моделей и не вызывает сомнений. Однако точные механизмы этого эффекта до конца не известны. Поскольку именно селенсодержащие белки опосредуют эти механизмы, детальное изучение каждого из членов семейства селенсодеожащи х белков в отдельности, а также их взаимодействие позволит детально описать многообразие метаболически х путей и физиологических эффектов селена в эмбриогенезе.

Селеновый белок V (SelV) Новый селеновый белок V (SelV) являлся гомологом известного белка SelW, однако его N-концевая последовательность содержала дополнительный домен, богатый пролином. Согласно проведённым экспериментам по его локализации на органном и тканевом уровнях, мы заключили, что, поскольку белок локализован в семенниках (сперматоцитах), он может играть важн ую роль в сперматогенезе.

Рисунок 17. А. Множес твенное выравнивание последовательностей SelV и SelW Б. Норзерн дот гибридизация SelV. В. In situ гибридизация семенников м ыши с антисм ысловой пробой гена SelV.

Одним из основных эффектов селена считается его влияние на мужскую фертильность, что особенно хорошо показано на мышиных моделях, в которы х с помощью генетических манипуляций нарушен нормальный синтез и/или метаболизм селен-содержащи х белков. Эти белки, в свою очередь, являются посредниками, обеспечивающими эффекты селена, и очевидно, что селен содержащий белок SelV является одним из ключевых составляющих селенопротеома семенников млекопитающих.

Исследование селенового белка Н (SelH) Множественное выравнивание доступных последовательностей SelH белков показало наличие консервативного СХХU мотива, окруженного N-концевым бета слоем и С-концевой альфа спиралью, что характерно для тиоредоксин-подобной укладки тиоловых оксидоредуктаз (Рис. 17). Таким образом, мы предположили, что SelH является оксидоредуктазой, в которой CXXU мотив играет роль в обратимой окислительно - восстановительной группе.

Последующий анализ последовательности показал возможное наличие Сигнала Ядерной Локализации (RKRK), при этом аргинины в положении 6 и (нумерация по последовательности SelH мы ши) являлись абсолютно консервативными, что указывает на их существенную роль в ядерном импорте как части Сигнала Ядерной Локализации (Рис. 18).

Рисунок 18. Множес твенное вырав нивание ряда селеновых белк ов H. Сигнал ядерной локализации и консервативный редокс мотив указаны.

Для исследования внутриклеточной локализации белка SelH мы приготовили химерные конструкции, схематично изображенные на рисунке 19. Сначала мы заменили TGA кодон (Sec) вн утри открытой рамки считывания на TGT, кодирующий цистеин для предотвращения терминации трансляции. Используя полученную последовательность, мы клонировали полноразмерный цистеиновый мутант SelH в pEGFP-N2 вектор, клонировали N-концевую его часть, предположительно содержащую Сигнал Ядерной Локализации.

Кроме того, мы приготовили мутантные формы для обеих вышеописанных конструкций, в которых аргинины (R) в положении 6 и 8 были заменены на серины, таким образом нарушая ядерный сигнал (Рис. 19).

Рисунок 19. Схема, иллюс трирующая структуру использованных химерных конс трукций.

Сверху – структура мРНК SelH. 5’UTR и - 3’UTR нетранс лиров аннаые пос ледов ательнос ти.

Трансфекция клеток млекопитающи х с последующей визуализацией с помощью конфокальной микроскопии показала, что химеры с полноразмерной и N-концевой последовательностью имеют ядерную локализацию, тогда как в случае замены консервативных аргининов на серины флуоресценция наблюдалась как в ядре, так и в цитоплазме, соответственно ядерная локализация SelH действительно определяется предсказанным сигналом, ключевыми компанентами которого действительно являются аргинины в позиции 6 и 8 (Рис. 20).

Рисунок 20. Лок ализация SELH-GFP химер в трансфецированных к летках. Нумерация конструкций соотв етс твует таков ой на предыдущ ей схеме.

Поскольку в случае конструкции образовался белок, содержащий полноразмерный SelH, при этом наблюдали преимущественное окрашивание определённых структур внутри ядра, мы использовали эту конструкцию в экспериментах по одновременному тройному мечению с маркерами для ядрышек (нуклеолы, маркер - нуклеолин) и нуклеоплазмы (U2B). Как видно на рисунке, зелёная флуоресценция, соответствующая SelH, соответствует красной, что указывает на то, что SelH является белком ядры шек (Рис. 21). Таким образом, мы показали, что SelH локализуется в ядры шках клеток млекопитающи х.

SelH-GFP U2B Nucleolin Совмешение Рисунок 21. Тройное мечение яд ер NIH 3T3 к леток транс фециров анной SELH-GFP химерой, м аркером ядрышек (анти-нуклеолин), и маркером нуклеоплазмы (анти-U2B) антителами.

In silico анализ экспрессии гена SelH показал, что и мышиная, и человеческая мРНК этого гена присутствует во многих, если не во всех тканях и органах.

Однако, большинство EST происходило либо из эмбриональных, либо из малигнизированных тканей, в частности из карцином. Более того, анализ SAGE баз данных позволил предположить, что экспрессия человеческого SelH усилена в опухолях щитовидной железы, лёгких и печени, а у мыши – в развивающемся мозге. Мы напрямую проанализировали экспрессию мРНК SelH методом Норзерн блоттинга, используя мы шиные эмбриональные ткани и ткани половозрелых животных (Рис. 22 и 23). Наиболее сильный сигнал был выявлен в образцах тканей, полученных на ранних стадиях эмбрионального развититя, а во взрослом состоянии – в тимусе, мозге и тестикулах. В проанализированных клеточных линиях самый сильный сигнал наблюдался в LCC1 (рак лёгкого), LNCaP (человеческая карцинома простаты), MCS1 (клетки Сертоли мыши), и NIH 3T (мышиные фибробласты) клеточных линиях. Методом Вестерн блоттинга мы показали, что SelH белок наиболее представлен в селезёнке и мозге, а в остальных тканях – не определялся. Также, согласно данными Норзерн блоттинга, наиболее высокая экспрессия белка SelH наблюдалась в LNCaP и LCC1 клеточных линиях.

Рисунок 22. Тканевое распределение SelH.

Эти две клеточные линии были использованы для дальнейших экспериментов по метаболическому мечению и субклеточному фракционированию с последующим анализом радиоавтографов ПААГ гелей (Рис. 24). Полоса размером 14 кДа, соответствующая размеру SelH, была обогащена в ядерной фракции. Эта фракция была разделена на ядрышковую фракцию и нуклеоплазму, и проанализирована методом Вестерн блоттинга. Подобно нуклеолину, ядрышковому маркеру, находился в нуклеолах. Дальней шие SelH иммуногистохимические эксперименты подтвердили локализацию SelH в ядрышках.

Поскольку предположительно вовлечён в окислительно SelH восстановительные реакции, мы исследовали его физиологическое значение для клетки, используя технологию РНК интерференции. Были приготовлены стабильные клеточные нокдауны на основе LCC1 клеточной линии. Отсутствие экспрессии гена проверялось методом Норзерн блоттинга (Рис. 25А, верхняя панель), а отсутствие экспрессии белка – методом Вестерн блоттинга (Рис. 25А, нижняя панель).

В дальней шем, эти клетки инкубировались с различными редокс активными агентами, включая перекись водорода, трет бутил гидропероксид, ДТТ, менадион и паракват. В инкубированных клетках измерялась выживаемость и сравнивалась в нокдаунах по сравнению с контрольными клетками, трансфецированными с вектором. Мы не наблюдали изменений в выживаемости клеток в эксперименте по сравнению с контролем, за исключением случая, когда использовалась H2 02. При концентрации 0.1-0.4 мМ выживаемость клеток с отсутств ующим SelH была существенно снижена (Рис.25Б). Таким образом, мы заключили, что белок SelH может играть важную роль в сопротивляемости этих клеток к оксидативному стрессу, индуцированному перекисью водорода.

Рисунок 23. Норзерн и В естерн блот анализы различных указанных тканей м ыши и клеточных линий.

24.

Рисунок Субк леточное фракционирование м етодом дифференциаль ного центрифугирования к леточной линии LCC1 с пос ледующим выяв лением сигнала S elH методом Вестерн-блотинга (ч ис тота фрак ций нуклеол пок азана на нижней панели). Прям ое иммуног истохим ическое в ыявление эндог енного SelH в к леточной линии LCC1.

А Б Рисунок 25. А – Стабильный нокдаун SelH в клеточной линии LCC1, пров еренный методом Норзерн блот анализа (вверху) и Вес терн блот анализа (внизу). Б – Пов ышенная чувствитель нос ть SelH–дефицитных клеток к перикиси водорода в сравнении с контроль ным и трансфецированными с век тором клеткам и.

Для того, чтобы выяснить биохимическую основу этого эффекта, мы использовали рекомбинантный мышиный SelH в ряде стандартных биохимических реакций. Был использована система тиоредоксина (TR и Trx), протекторная активность по отношению к глутамин синтетазе и система GR – GSH. Кроме того, в качестве контроля мы использовали мутантную форму, в которой sec был заменён на серин, что теоретически должно было нейтрализовать редокс- активность.

Мы не обнаружили отличий в активностях исследуемых реакций у СХХС и CXXS мутантных форм, кроме случая с глутатионом. На рисунке 26 представлены данные по глутатион пероксидазной активности SelH с перекисью водорода и трет бутил гидропероксидом. Как видно, SelH CXXC вариант обладал способностью восстанавливать перекись используя глутатион, и эта способность существенным образом зависела от присутствия цистеина в каталитическом центре.

Рисунок 26. Глу татион пероксидазная ак тивнос ть SelH c различными в идам и перекис и.

Указанные реком бинантные мутантные формы (CXXS или CXX C) SelH или лизат печени мыши в кач естве контроля были использов аны в стандартной спаренной реак ции. Единица активности определена как количес тво белк а, необход имог о для окисления 1 µmol NADP H/мин. Реакции были инициированы добав лением 300 µM H2O2 или 233 µM t-BOOH в качеств е субстрата.

Рисунок 27. Эволюционный анализ S elH последователь ностей эукариот.. Для пос троения филогенетич еского дерев а были использов аны с ледующ ие последователь нос ти из TM генетического банка (GenBank ): Gallus gallus SelH (46017578), Danio rerio S elH (31342376), Tet radon SelH (56305185), Anopheles gambiae SelH (27645579), Drosophila melanogaster BthD (14718671), Arabidopsis thaliana SelH1 (30689011), Arabidopsis thaliana SelH2 (50058858), Drosophila melanogaster SelH3 (24584864), Drosophila melanogaster SelH (113194556), Mouse SelH (82546880), Rat SelH (109470184), Pig SelH (87230686), Hum an SelH (3516960), Ciona savignyi SelH (51695500), Ciona intestinalis SelH (56083593), Drosophila yak uba SelH3 (84681766), Drosophila simulans S elH3 (61736437), Drosophila yakuba SelH (84681627), Drosophila simulans SelH2 (111276688), Drosophila yak uba BthD (84679567) и Drosophila simulans BthD (61714200).

Далее мы провели филогенетический анализ этих белков (Рис 27). SelH белки у животных разделяются на три ветви, основная из которых содержит последовательности селенсодержащи х форм данного белка. У различных видов дрозофил были найдены гомологи, содержащие в каталитическом центре CxxR или TxxC последовательности. Таким образом, мы показали, что SelH является новой селен-содержащей оксидоредуктазой ядры шек, вовлечённой в защиту клеток от оксидативного стресса.

Семейство Rdx белков.

Целый ряд селен-содержащи х белков млекопитающих имеют селеноцистеин, разделённый 0-2 аминокислотными остатками с консервативным цистеином. Среди них SelT, SelW, SelH и SelV содержат CXXU, при этом этот мотив расположен между предсказываемым бета слоем и альфа спиралью, что указывает на возможные аналогии с белками тиоредоксин-подобной укладки и подразумевает наличие окислительно-восстановительных функций.

Попарное сравнительное выравнивание этих последовательностей (SelT, SelW, SelH и SelV) не выявило значительной гомологии между ними, однако при использовании в программе PSI-BLAST последовательности SelT в качестве запроса в Nonreduntant базе данных мыобнаружили дополнительный неохарактеризованный белок молекулярной массой 12 кДа, содержащий СХХС мотив в месте СХХU мотива SelT. Данный белок был назван нами Rdx12.

Используя последовательность Rdx12 в качестве запроса в дальнейших поисках программой PSI-BLAST, мы обнаружили гомологию Rdx12 с рядом последовательностей SelW, SelH и SelV с Е величной, отражающую достоверность, ниже 0.1 (Е-value ниже 0.1). Более того, множественное выравнивание этих последовательностей выявило консервативность положения СХХС или СХХU (Рис. 28) в предполагаемом редокс каталитическом центре. Дальнейший поиск гомологов RDx12 белка позволил выявить такие белки у рыб, и у этих белков на месте второго цистеина в белке млекопитающих находился селеноцистеин (CXXU мотив в Rdx12 белке рыб).

Предсказания вторичной структуры этих белков показали наличие тиоредоксин-подобной укладки, с той разницей, что у ряда представленных последовательностей отсутствовала спираль. Эта спираль может отсутствовать в ряде тиоредоксин-подобных белков, как было показано для семейства Sep15/SelM.

Другим консервативным участком у гомологов Rdx12 была последовательность, находящаяся в середине концевой области tGxFEI(V).

Таким образом, базируясь на данных анализа первичной и вторичной структуры, мы заключили, что вышеописанные белки формируют собой новое семейство оксидоредуктаз, имеющи х тиоредоксино-подобную укладку и консервативный редокс мотив, и назвали его – Rdx-подобным семейством (Rdx подобные белки).

EEEEEEEEE HHHHHHHHHHHHH EEE EEEEEE EEEEEE HHHHHHHHHHHHHH 6677917 Mmu 1 MALAVRVVYCGAUGYKPKYLQLKEKLEHEFP---GCLDICGEG---TPQVT---GFFEVTVAGKLVHSKK(5)VDTESKFRKLVTAIK 81 [ 88] 2384721 Hs 1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFP---GRLDICGEG---TPQAT---GFFEVMVAGKLIHSKK(5)VDTESKFLKLVAAIK 81 [ 87] 29648542 Dr 1 MTVKVHVVYCGGUGYRPKFIKLKTLLEDEFP---NELEITGEG---TPSTT---GWLEVEVNGKLVHSKK(5)VDSDSKMQKIVTAIE 81 [ 86] 32492911 Hs 261 KRVLIRVTYCGLUSYSLRYILLKKSLEQQFP---NHLLFEEDR---AAQAT---GEFEVFVNGRLVHSKK(5)VN-ESRLQKIVSVID 340 [346] 34873611 Rn 21 SGVHIVVEYCKPCGFEATYLELASSLEEEYP----GIEIESR----LG-GT---GAFEIEINGQLVFSKL(5)PYEKDLMEAIRRASN 98 [115] EEEE HHHHHHHHHH EEEE HHHHH EEEE EEEE HHHHHHHHHH 1nho_A Mt 1 MVVNIEVFTSPTCPYCPMAIEVVDEAKKEFG---DKIDVEKIDIMVDREKA(6)AVPAIAINGVVRFVGA---PSREELFEAINDEME 85 [ 85] 11499728 Af 1 MVMMKLFTSPTCPYCPKAEKVVSKVAKEEG---VLAINLPVNTDEGLKEA(6)GVPALVINDKYLILGV---PDEGELRQLIRKLKG 84 [ 91] 45359198 Mma 1 MVKIEVFTSPMCPHCPAAKRIVDEVAKEIE----GIEVVHINVMEHPEKA(6)AVPTVAINGEVKFVGA---PTKDALIAELKK 80 [ 80] 15897143 Ss 143 GKVKIETVVTPSCPYCPYAALMAHMVAFEAC(4)CNVISEVIEAYENQDIA(6)SVPAIAINESIEFIGV---PYEENFINAILEKQK 231 [233] 14600959 Ap 138 GRVHIETIITPSCPYCPYAVLLAHMFAYEAW(4)PVILSEAVEAYENPDIA(6)SVPSIAINGYLVFVGV---PYEEDFLDYVKSAAE 226 [243] Рисунок 28. Множ еств енное выравнивание Rdx12 белков эукариот.

Тканевая экспрессия Rdx подобных белков млекопитающих.

Для изучения экспрессии Rdx12 белков был использован метод норзерн блоттинга с различными тканями мы ши. Согласно нашим данным, наиболее высокая экспрессия SelT мРНК наблюдалась в почках, затем в мозге, сердце и тимусе, тогда как Rdx12 мРНК была наиболее представлена в почках, а также в мозге и в яичниках. SelW мРНК была наиболее представлена в мозге и скелетных мышцах мы ши (Рис. 29).

Рисунок 29. Норзерн блот анализ различных тк аней мыши с указанными пробами.

Ткани приведены в с ледующем порядке – слева направо: м озг, серд це, легкое, печень, селезенка, почка, желудок, тонкий кишеч ник, скелетная мышца, тимус, яичник, матк а и плацента.

Внутриклеточная локализация Rdx12 белков. Ранее было показано, что SelW является цитоплазматическим белком, однако о локазизации новых Rdx12 и SelT до настоящего времени ничего не было известно. Анализ последовательности Rdx12 не выявил специфических сигналов внутриклеточной локализации, и дальнейшие эксперименты с химерами Rdx12 и GFP это подтвердили. При трансфекции клеток NIH 3T3 с конструкциями, содержащими эти химеры, флуоресценция распределялась по всей клетке и не отличалась от таковой в контроле, когда клетки трансфецировались с GFP. Таким образом, также как SelW, Rdx12 имеет преимущественно цитоплазматическую, и возможно, частично ядерную, локализацию.

Множественное выравнивание Rdx12 белков выявило удлинение концевой последовательности у SelT белка, и этот N-концевой участок обладает характерными признаками сигнального пептида. Чтобы проверить, вовлечена ли эта последовательность в субклеточную локализацию белка SelT, мы приготовили ряд конструкций химер полноразмерного SelT или без N-концевого участка с GFP, и трансфецировали клетки. Как показано на рисунке 30, полноразмерный SelT имел необычное распределение по клетке, и оно не зависело от присутствия N-конца, т.к. редуцированная без N-конца форма была локализована подобно полноразмерной. Напротив, когда N-концевой пептид был соединён с GFP, флуоресценция наблюдалась равномерно по клетке, что указывало на независимость внутриклеточной локализации белка от этой N-концевой последовательности.

В дальнейшем мs использовали различные маркеры клеточных органелл, для выяснения внутриклеточной локализации SelT. Мы исключили лизосомальную, митохондриальную и пероксисомальную локализацию SelT, однако сигнал частично перекрывался при использовании маркеров ЭПР или аппарата Гольджи (Рис. 30). Таким образом, мы показали, что SelT локализован в аппарате Гольджи и, возможно, частично в ЭПР и цитозоле.

Рисунок 30. Внутриклеточная локализация SelT.

Левая панель – ЭПР маркер, прав ая панель – Гольджи м аркер. Образцы на лев ой и прав ой панелях идентич ны.

Поиск белков-партнёров Rdx12 и SelW у млекопитающих.

Наличие тиоредоксин-подобной укладки и СХХС мотива предполагает дальнейшие аналогии с тиредоксином в контексте механизма его каталитического цикла. Во время реакции тиоредоксины формируют временные межмолекулярные дисульфидные связи с белками-мишенями с помощью N-концевого цистеина, который восстанавливается вторым цистеином каталитического редокс-центра.

Замена восстанавливающего цистеина на серин приводит к стабилизации межмолекулярной связи, и, соответственно, селективного связывания тиоредоксина с белком-партнёром с дальнейшей возможностью разрушения данной связи дитиотрийтолом и идентификации этих партнёров с помощью масс спектрометрии. Этот принцип был применен при поиске белков, взаимодействующи х с SelW и Rdx12.

Мы приготовили рекомбинатные формы SelW и Rdx12 белков в виде экспрессированых в E. coli мутантных СХХS и SXXC форм, содержащи х также концевой полигистидиновый кластер для аффинной очистки.

СХХS и SXXC рекомбинантные формы Rdx12 белка были очи щены и иммобилизированны на бром-циан сефарозе, и цитоплазматическая фракция клеток печени была использована для поиска мишеней. На рисунке 31 представлен ПААГ элюатов с соответствующих аффиных матриксов, покрашенный серебром.

Наиболее ярко прокрашенные белковые полосы были выделены и проанализированы методом масс спектрометрии.

Среди возможных партнёров были идентифицированы: сам Rdx12 (белок, смытый в небольшом количестве с матрикса), а также глутатион пероксидаза (GPx1), пероксиредоксин 1 и глутатион-с-трансфераза. Чтобы оценить специфичность этих взаимодействий, мы напрямую исследовали возможность Rdx12 связывать GPx1. Для этого меченные Se75 печеночные ткани мыши инкубировались с SXXC формой Rdx12. Сравнение, показанное на рисунке, между грубым экстрактом (линия 1), проскоком и аффинно связанной фракцией показывает значительное обогащение полосы размером 25 кДа, соответствующей глутатион пероксидазе 1, подтверждая то, что последний является партнёром белка Rdx12.

Рисунок 31. А – покрашенные серебром ПААГ белков -мишеней Rdx 12. Б – аффинное обогащ ение GPx1 на Rdx 12 матриксе.

Подобная процедура была применена для SelW. В качестве мишени была использована цитоплазматическая фракция мозга мыши, т.к. согласно данным норзерн блот анализа, это была самая обогащенная по мРНК SelW ткань.

На рисунке 32 представлен прокрашенный серебром ПААГ гель, содержащий полученные белки-партнёры Среди них были SelW.

идентифицированы пероксиредоксин 1 (полоса В1), 14-3-3 (полоса В2), ди гидро пиримидиназа-связанный белок 2 (полоса В3), и белки теплового шока 70 и (полосы В5 и В6, соответственно).

Подобные результаты были получены в том случае, когда мы использовали цитоплазму кардиомиоцитов. В этом случае наиболее обогатившимися были пероксиредоксин 1 и 14-3-3 белок. Этот факт дал нам основание заключить, что SelW возможно имеет одинаковый набор партнёров в этих тканях, среди которых представлены: пероксиредоксин 1, 14-3-3 белок и белки теплового шока 70 и 90;

более того, каждый из этих наборов содержит ферменты, вовлечённые в окислительно-восстановительные реакции.

Рисунок 32. Покрашенные серебром ПААГ белков-мишеней SelW.

Суммируя вы шесказанное, можно заключить, что иденти фицировано новое семейство белков, названное нами Rdx, которое имеет большое количество селеноцистеин-содержащих представителей. Четыре из двадцати пяти селен содержащих белков человека (SelT, SelW, SelH и SelV) являются его представителями, как показано на схеме (Рис. 33). Консервативность СХХС(U) мотива и тиоредоксин-подобной укладки указывают на наличие окислительно восстановительной фун кции этих белков. Не исключено, что количество белков партнёров значительно больше, среди них SelW взаимодействует с белком 14-3-3 и Rdx с глутатион пероксидазой 1. Наиболее характерным признаком этого семейства белков является многообразие вариантов строения каталитического центра (Рис. 33).

Рисунок 33. Схем а строения каталитического центра Rdx белков.

Существование многих форм членов семейства Rdx, которые локализованы в различных органеллах клетки, а также неравномерно распределены по тканям организма животных свидетельствуют о том, что разные представители этого семейства могут нести различные функциональные нагрузки. Это указывает на возможное различие как субстратной специфичности этих белков, так и их ферментативной активности. Соответственно, разные представители этого семейства могут быть вовлечены в различные пути метаболизма клетки, что открывает новые возможности и направления будущи х исследований.

Выводы 1. На основании проведенного филогенетического анализа было установлено, что из существующи х двух форм тиоредоксин редуктазы животных («большая» и «малая»), «большая» форма эволюционно образовалась на уровне низши х эукариот значительно раньше, чем «малая» форма TR была утеряна в организмах, от которы х произошли животные. Обе эти формы сосуществовали в процессе эволюции. Мы идентифицировали организм (Chlamydomonas reihardti), который содержит оба фермента. Среди высши х эукариот «большая» форма стала преобладать у животных, тогда как «малая» сохранилась в растениях и грибах.

2. «Большая» форма тиоредоксин редуктазы произошла от глутатион редуктазы низших эукариот путём удлинения карбокситерминального конца белка с появлением консервативного Gly-SecCys-Cyc-Gly мотива в новом каталитическом окислительно-восстановительном центре, который фун кционально заменил глутатион в качестве промежуточного (транзиторного) субстрата для этого фермента.

3. Иденти фицирован и охарактеризован новый митохондриальный глутаредоксин (Grx2). Grx2 человека и мы ши катализирует восстановление смешанных дисульфидных связей, сформированных между глутатионом и HEDS, S сульфоцистеином или L-цистеином. На основании кинетических данных установлено, что Grx2 обладает наиболее высоким сродством по отношению к L цистеину, и это сродство было эквивалентно таковому для HEDS и S сульфоцистеина.

4. Показано, что белок TR2 структурно является тиоредоксин-глутатион редуктазой (TGR), при этом in vitro он обладает тиолтрансферазной, глутатион и тиоредоксин редуктазной, а также протеин дисульфид изомеразной активностью.

Функционально TGR представляет собой изомеразу, одним из субстратов которой выявлена глутатион пероксидаза 4 (Gpx4), и, следовательно, TGR вовлечёна в образование митохондриальной капсулы сперматозоидов.

5. Иденти фицирован и охарактеризован новый селен-содержащий белок SelM, имеющий новый тип SECIS элемента.

6. Компьютерный анализ генома человека показал, что селенопротеом состоит из 25 селен-содержащих белка, семь из которы х ранее не были известны. Среди них охарактеризованы новая глутатион пероксидаза Gpx6, экспрессирующаяся в обонятельном эпителии на определённых стадиях эмбриогенеза, а также селен содержащий белок SelV – белок сперматоцитов.

7. Установлено, что селен-содержащий белок SelH - новая тиоловая оксидоредуктаза ядры шек, имеющая необычный паттерн экспрессии.

8. Обнаружена новая тиоловая оксидоредуктаза эукариот, названная нами Rdx12.

На основании компъютерного анализа белок Rdx12, селен-содержащий белок SelW, селен-содержащий белок SelV, селен-содержащий белок SelT и селен содержащий белок SelН были объединены в новое семейство тиоловых оксидоредуктаз с тиоредоксин-подобной укладкой. Это семейство было охарактеризовано и названо нами Rdx.

Список публикаций 1. Novoselov SV, Lobanov AV, Hua D, Kasaikina MV, Hatfield DL, Gladyshev VN.

A highly efficient form of the selenocysteine insertion sequence element in protozoan parasites and its use in mammalian cells. Proc Natl Acad Sci U S A. 2007 May 8;

104(19):7857-7862.

2. Novoselov SV, Kryukov GV, Xu XM, Carlson BA, Hatfield DL, Gladyshev VN.

Selenoprotein H is a nucleolar thioredoxin- like protein with a unique expression pattern.

J Biol Chem. 2007 Apr 20;

282(16):11960-11968.

3. Novoselov SV, Hua D, Lobanov AV, Gladyshev VN.

Identification and characterization of Fep15, a new selenocysteine-containing member of the Sep15 protein family.

Biochem J. 2006 Mar 15;

394(Pt 3):575-579.

4. Novoselov SV, Calvisi DF, Labunskyy VM, Factor VM, Carlson BA, Fomenko DE, Moustafa ME, Hatfield DL, Gladyshev VN.

Selenoprotein deficiency and high levels of selenium compounds can effectively inhibit hepatocarcinogenesis in transgenic mice.

Oncogene. 2005 Dec 1;

24(54):8003-8011.

5. Novoselov SV, Gladyshev VN.

Non-animal origin of animal thioredoxin reductases: implications for selenocysteine evolution and evolution of protein function through carboxy-terminal extensions.

Protein Sci. 2003 Feb;

12(2):372-378.

6. Novoselov SV, Rao M, Onoshko NV, Zhi H, Kryukov GV, Xiang Y, Weeks DP, Hatfield DL, Gladyshev VN.

Selenoproteins and selenocysteine insertion system in the model plant cell system, Chlamydomonas reinhardtii.

EMBO J. 2002 Jul 15;

21(14):3681-3693.

7. Novoselov SV, Peshenko IV, Popov VI, Novoselov VI, Bystrova MF, Evdokimov VA, Kamzalov SS, Merkulova MI, Shuvaeva TM, Lipkin VM, Fesenko EE.

Localization of 28-kDa peroxiredoxin in rat epithelial tissues and its antioxidant properties.

Cell Tissue Res. 1999 Dec;

298(3):471-480.

8. Bonilla M, Denicola A, Novoselov SV, Turanov AA, Protasio A, Izmendi D, Gladyshev VN, Salinas G.

Platyhelminth mitochondrial and cytosolic redox homeostasis is controlled by a single thioredoxin glutathione reductase and dependent on selenium and glutathione.

J Biol Chem. 2008 Jun 27;

283(26):17898-17907.

9. Sengupta A, Carlson BA, Weaver JA, Novoselov SV, Fomenko DE, Gladyshev VN, Hatfield DL.

A functional link between housekeeping selenoproteins and phase II enzymes.

Biochem J. 2008 Jul 1;

413(1):151-161.

10. Merchant SS, Prochnik SE, Vallon O, Harris EH, Karpowicz SJ, Witman GB, Terry A, Salamov A, Fritz- Laylin LK, Marchal-Drouard L, Marshall WF, Qu LH, Nelson DR, Sanderfoot AA, Spalding MH, Kapitonov VV, Ren Q, Ferris P, Lindquist E, Shapiro H, Lucas SM, Grimwood J, Schmutz J, Cardol P, Cerutti H, Chanfreau G, Chen CL, Cognat V, Croft MT, Dent R, Dutcher S, Fernndez E, Fukuzawa H, Gonzlez-Ballester D, Gonzlez-Halphen D, Hallmann A, Hanikenne M, Hippler M, Inwood W, Jabbari K, Kalanon M, Kuras R, Lefebvre PA, Lemaire SD, Lobanov AV, Lohr M, Manuell A, Meier I, Mets L, Mittag M, Mittelmeier T, Moroney JV, Moseley J, Napoli C, Nedelcu AM, N iyogi K, Novoselov SV, Paulsen IT, Pazour G, Purton S, Ral JP, Riao-Pachn DM, Riekhof W, Rymarquis L, Schroda M, Stern D, Umen J, Willows R, Wilson N, Zimmer SL, Allmer J, Balk J, Bisova K, Chen CJ, Elias M, Gendler K, Hauser C, Lamb MR, Ledford H, Long JC, Minagawa J, Page MD, Pan J, Pootakham W, Roje S, Rose A, Stahlberg E, Terauchi AM, Yang P, Ball S, Bowler C, Dieckmann CL, Gladyshev VN, Green P, Jorgensen R, Mayfield S, Mueller-Roeber B, Rajamani S, Sayre RT, Brokstein P, Dubchak I, Goodstein D, Hornick L, Huang YW, Jhaveri J, Luo Y, Martnez D, Ngau WC, Otillar B, Poliakov A, Porter A, Szajkowski L, Werner G, Zhou K, Grigoriev IV, Rokhsar DS, Grossman AR.

The C hlamydomonas genome reveals the evolution of key animal and plant functions.

Science. 2007 Oct 12;

318(5848):245-250.

11. Shchedrina VA, Novoselov SV, Malinouski MY, Gladyshev VN.

Identification and characterization of a selenoprotein family containing a diselenide bond in a redox motif.

Proc Natl Acad Sci U S A. 2007 Aug 28;

104(35):13919-13924.

12. Dikiy A, Novoselov SV, Fomenko DE, Sengupta A, Carlson BA, Cerny RL, Ginalski K, Grishin NV, Hatfield DL, Gladyshev VN.

SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin- like family.

Biochemistry. 2007 Jun 12;

46(23):6871-6882.

13. Shrimali RK, Weaver JA, Miller GF, Starost MF, Carlson BA, Novoselov SV, Kumaraswamy E, Gladyshev VN, Hatfield DL.

Selenoprotein expression is essential in endothelial cell development and cardiac muscle function.

Neuromuscul Disord. 2007 Feb;

17(2):135-142.

14. Lobanov AV, Delgado C, Rahlfs S, Novoselov SV, Kryukov GV, Gromer S, Hatfield DL, Becker K, Gladyshev VN.

The Plasmodium selenoproteome.

Nucleic Acids Res. 2006 Jan 20;

34(2):496-505.

15. Sun QA, Su D, Novoselov SV, Carlson BA, Hatfield DL, Gladyshev VN.

Reaction mechanism and regulation of mammalian thioredoxin/glutathione reductase.

Biochemistry. 2005 Nov 8;

44(44):14528-14537.

16. Castellano S, Lobanov AV, Chapple C, Novoselov SV, Albrecht M, Hua D, Lescure A, Lengauer T, Krol A, Gladyshev VN, Guig R.

Diversity and functional plasticity of eukaryotic selenoproteins: identification and characterization of the SelJ family.

Proc Natl Acad Sci U S A. 2005 Nov 8;

102(45):16188-16193.

17. Su D, Novoselov SV, Sun QA, Moustafa ME, Zhou Y, Oko R, Hatfield DL, Gladyshev VN.

Mammalian selenoprotein thioredoxin- glutathione reductase. Roles in disulfide bond formation and sperm maturation. J Biol Chem. 2005 Jul 15;

280(28):26491-26498.

18. Castellano S, Novoselov SV, Kryukov GV, Lescure A, Blanco E, Krol A, Gladyshev VN, Guig R.

Reconsidering the evolution of eukaryotic selenoproteins: a novel nonmammalian family with scattered phylogenetic distribution.

EMBO Rep. 2004 Jan;

5(1):71-77.

19. Carlson BA, Novoselov SV, Kumaraswamy E, Lee BJ, Anver MR, Gladyshev VN, Hatfield DL.

Specific excision of the selenocysteine tRNA[Ser]Sec (Trsp) gene in mouse liver demonstrates an essential role of selenoproteins in liver function.

J Biol Chem. 2004 Feb 27;

279(9):8011-8017.

20. Rao M, Carlson BA, Novoselov SV, Weeks DP, Gladyshev VN, Hatfield DL.

Chlamydomonas reinhardtii selenocysteine tRNA[Ser]Sec.

RNA. 2003 Aug;

9(8):923-930.

21. Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guig R, Gladyshev VN.

Characterization of mammalian selenoproteomes.

Science. 2003 May 30;

300(5624):1439-14343.

22. Романова ЛГ, Новосёлов СВ, Егоров ММ, Костина МБ, Шакшпаронов МИ.

Экспрессия H+,K+-ATPase каталитической субъединици в эпидермисе крысы.

Биоорганическая химия. 2002 Jul-Aug;

28(4):351-356.

23. Korotkov KV, Novoselov SV, Hatfield DL, Gladyshev VN.

Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element.

Mol Cell Biol. 2002 Mar;

22(5):1402-1411.

24. Gladyshev VN, Liu A, Novoselov SV, Krysan K, Sun QA, Kryukov VM, Kryukov GV, Lou MF.

Identification and characterization of a new mammalian glutaredoxin (thioltransferase), Grx2.

J Biol Chem. 2001 Aug 10;

276(32):30374-30380.

25. Новосёлов ВИ, Амелина СЕ, Кравченко ИН, Новосёлов СВ, Янин ВА, Садовников ВБ, Фесенко ЕЕ.

Роль пероксиредоксина в антиоксидантной системе лёгких.

Доклады АН. 2000 Jul-Dec;

373-375:64-66.

26. Новосёлов ВИ, Пешенко ИВ, Новосёлов СВ, Камзалов СС, Быстрова МФ, Евдокимов ВА, Николаев ЮВ, Фесенко ЕЕ.

Протекторная активность 28 кДа 1-цис пероксиредоксина определяется его пероксидазной активностью. Биофизика. 1999. 44(3):568-570.

27. Merkulova MI, Andreeva SG, Shuvaeva TM, Novoselov SV, Peshenko IV, Bystrova MF, Novoselov VI, Fesenko EE, Lipkin VM.

A novel 45 kDa secretory protein from rat olfactory epithelium: primary structure and localisation.

FEBS Lett. 1999;

450(1-2):126-130.

28. Андреева СГ, Меркулова МИ, Шуваева ТМ, Новосёлов ВИ, Пешен ко ИВ, Новосёлов СВ, Фесенко ЕЕ, Липкин ВМ.

Структурные исследования секреторного 28 кДа из обонятельного эпителия крысы.

Биоорганическая химия. 1998;

24(11):816-821.

29. Новосёлов ВИ, Пешенко ИВ, Евдокимов ВА, Камзалов СС, Новосёлов СВ, Николаев ЮВ, Быстрова МФ, Фесенко ЕЕ.

Свойства каталитического центра секреторного 28 кДа белка из обонятельного эпителия крысы.

Биофизика. 1998;

43(4):610-616.

30. Gladyshev VN and Novoselov SV Compositions and Methods for the Expression of Selenoprotein in Eukaryotic Cells.

Заявка в Патентное бюро США - U.S. Provisional Patent Application Serial No. 1/125,822 от 29 арпеля 31. Carlson BA, Xu XM, Shrimarli R, Sengupta A, Yoo MH, Zhong N, Hatfield DL, Irons R, Davis CD, Lee BJ, Novoselov SV, Gladyshev VN.

Mouse models for assessing the role of selenium in health and development.

В сборнике: Selenium: Its M olecular Biology and role in Human Health. Springer, 2006. 333-343.

Список сокращений:

АФ А – активные формы азота АФ К – активные формы кис лорода EST –(expressed sequence tag) генетические транскрипты КАТ – каталаза GFP – зелёный флуоресцентный белок GPx – глутатион пероксидаза GR – глу татион редуктаза Grx – глу таредоксин GSH – восс танов ленный глу татион GSSG – окис ленный глу татион LADH - липоамид дегид рогеназами NADP H – ник отинамидадениндинуклеотид фос фат Prx – пероксиредоксин RSH – в осстанов ленный субс трат RSSR – окисленный субстрат Sec – селеноцис теин TR – тиоред оксин редуктаза Trx – тиоредоксин

 




 
2013 www.netess.ru - «Бесплатная библиотека авторефератов кандидатских и докторских диссертаций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.