авторефераты диссертаций БЕСПЛАТНАЯ  БИБЛИОТЕКА

АВТОРЕФЕРАТЫ КАНДИДАТСКИХ, ДОКТОРСКИХ ДИССЕРТАЦИЙ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ

Pages:   || 2 |

Структурные и функциональные характеристики природных и хирально модифицированных модельных ионных каналов

-- [ Страница 1 ] --

На правах рукописи

ДМИТРИЕВ АНДРЕЙ ВИКТОРОВИЧ СТРУКТУРНЫЕ И ФУНКЦИОНАЛЬНЫЕ ХАРАКТЕРИСТИКИ ПРИРОДНЫХ И ХИРАЛЬНО МОДИФИЦИРОВАННЫХ МОДЕЛЬНЫХ ИОННЫХ КАНАЛОВ Специальность 03.00.02 – биофизика

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора физико-математических наук

Москва – 2009

Работа выполнена на кафедре гуманитарных и естественнонаучных дисциплин Филиала Орловской региональной академии государственной службы в г. Ли пецке

Научный консультант: доктор физико-математических наук, профессор Твердислов Всеволод Александрович Официальные доктор физико-математических наук оппоненты: Быстров Владимир Сергеевич доктор физико-математических наук Ермаков Юрий Александрович доктор биологических наук Лопина Ольга Дмитриевна

Ведущая организация: Институт биохимической физики имени Н.М. Эмануэля РАН

Защита состоится « 16 » апреля 2009 года в 1530 часов на заседании Совета по защите диссертаций Д 501.002.11 по физико-математическим наукам при Мос ковском государственном университете им. М.В. Ломоносова по адресу: Ленин ские горы, Москва, ГСП-1, 119991, МГУ, Физический факультет, кафедра био физики, ауд. 5-19.

С диссертацией можно ознакомиться в библиотеке Физического факультета МГУ им. М.В. Ломоносова

Автореферат разослан « _ » _ 2009 года

Ученый секретарь Диссертационного совета Д 501.002. доктор физико-математических наук Г.Б. Хомутов

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность работы. Перенос ионов через биологические мембра ны является одним из наиболее важных процессов, происходящих в живых клет ках. Обеспечивая общую термодинамическую неравновесность клетки, он игра ет основополагающую роль в таких важнейших физиологических процессах, как преобразование энергии, поддержание постоянного химического состава внут ренней среды, регуляция и рецепция, биологическая подвижность, распростра нение импульса и др. Так как липидный бислой мембраны создает исключитель но высокий энергетический барьер для прохождения ионов, то осуществление ионного транспорта требует наличия специализированных макромолекулярных структур, которые могли бы существенно уменьшить этот энергетический барь ер. Именно эту роль выполняют ионные насосы, ионные каналы, ионообменни ки, антибиотики. Среди различных ион-транспортных систем ионные каналы ха рактеризуются относительно высокой скоростью транспорта в сочетании с вы сокой селективностью к транспортируемым ионам.

Центральной проблемой в исследовании физических свойств ионных ка налов является установление связи между их структурой и функциями. Появле ние экспериментальной информации по структуре ионных каналов стимулиро вало разработку различных теоретических подходов к исследованию механизмов переноса ионов в каналах, основывающихся, прежде всего, на уравнениях моле кулярной и броуновской динамики, теории абсолютных скоростей реакций Эй ринга и теории диффузии Пуассона-Нернста-Планка. Вместе с тем прогресс в теоретическом исследовании механизмов переноса ионов существенно затруд нен из-за отсутствия единого подхода к оценке энергетических профилей ионов в канале, которые, в явном или неявном виде, включены во все вышеуказанные уравнения. Следствием этого является физически неоднозначная калибровка па раметров энергетических профилей и уравнений для расчета функциональных характеристик каналов, таких как проводимости, ионные токи, вольтамперные характеристики и отношения коэффициентов проницаемостей для различных ионов.

Ионная асимметрия в содержании важнейших катионов во внутренней среде клеток относительно внешней среды, формируемая при участии ионных насосов и ионных каналов, непосредственным образом связана с другой фунда ментальной асимметрией – хиральной асимметрией важнейших биомолекул во всей биосфере, которая проявляется в построении нуклеиновых кислот из D энантиомеров (дезокси)рибозы, а синтезируемых в рибосомах белков – из L энантиомеров аминокислот. Так существуют близкие значения свободной энер гии, необходимой для формирования хирально чистых биополимеров и ионной асимметрии клеток (Твердислов и Яковенко, 2003).

Рассматривая общие структурные и функциональные особенности живой клетки, целесообразно выделить два аспекта нарушения зеркальной симметрии биомолекул. Во-первых, это эволюционно востребованная необходимость гомо хиральности, во-вторых – эволюционно закрепившийся знак хиральности.

Физико-химические и биологические основы гомохиральности биополи меров в последнее время изучены достаточно разносторонне (Аветисов, Голь данский, 1996;

Чернавский, 2000;

Твердислов, Яковенко, 1992, 2008). Так гомо хиральность белков и нуклеиновых кислот определяет их стереоспецифичность – необходимое условие матричного синтеза, обусловливает стабильность их структур, обеспечивающих их функционирование. Для биохимических преобра зований гомохиральных соединений требуется значительно меньший набор ферментов, чем для таких же преобразований гетерохиральных соединений. Ос новы механизмов сопряжения ионной и хиральной асимметрий рассмотрены в работах Твердислова, Яковенко, Дмитриева (1988 - 2008).

Несмотря на значительные успехи, достигнутые в области исследования гомохиральности биополимеров, физико-химическое и биологическое основы того, что белки-ферменты и нуклеиновые кислоты имеют строго определенный знак хиральности, остаются недостаточно выясненными. Интерес к этой про блеме усиливается тем, что, согласно гипотезам спонтанной дерацемизации и решающей роли глобального фактора преимущества (Гольданский и Кузь мин,1989), повторение всей совокупности событий, приведших к появлению хи ральной чистоты, равновероятно способно привести к такой гипотетической биосфере, которая использовала бы D-аминокислоты и L-сахара.

Следует отметить, что, помимо сахаров и аминокислот, другие хиральные компоненты клетки в определенных случаях могут встречаться как в одной, так и в другой изомерной форме. В некоторых бактериях обнаружены L-сахара и D аминокислоты. D-аминокислоты достаточно широко распространены в живой природе и, более того, входят в состав ряда биологически значимых коротких олигопептидов. Встречаются бактерии, которые содержат D-глютаминовую ки слоту и D-Ala в своих клеточных стенках, а в организме человека вырабатывает ся в качестве нейромедиатора D-Ser. Некоторые пептидные антибиотики, а так же плазма крови высших организмов, имеют в своем составе D-аминокислоты.

Некоторые термофилы используют высокие концентрации D-Ala в качестве ос морегулятора. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, иногда в значительных концентрациях. Поэтому в деталях биологический мир не обнаруживает хиральной чистоты, но все, что относится к рибосомаль ному синтезу полипептидов, характеризуется абсолютной хиральной чистотой.

Нарушение хиральной чистоты аминокислот в белках является следствием их посттрансляционной модификации – неферментативной рацемизации и изо меризации аминокислот в белках. Причем из двадцати аминокислот, участвую щих в рибосомальном синтезе, прежде всего Asp- и Asn-остатки в белках явля ются наиболее подверженными неферментативной модификации: рацемизации и изомеризации. Если накопление остатков D-Asp в белках – достаточно долгий процесс, который является наиболее значимым для очень медленно обновляю щихся белков и белков организма, вовлеченных в патофизиологические процес сы при заболеваниях пожилого возраста, то появление остатков iAsp в белках – существенно для функционирования медленно обновляющихся белков даже в норме.

Посттрансляционные неферментативные модификации аминокислот в белках играют существенную роль в патогенезе болезней, характерных для лю дей пожилого возраста. Так установлено появление значительного содержания остатков D-Asp в белках организмов с болезнью Альцгеймера, Паркинсона, а также при склеротических изменениях в сердечно-сосудистой системе, при глаз ной катаракте и т.д. Некоторые исследователи рассматривают содержание остат ков D-Asp в белках как патофизиологический фактор в патогенезе болезней по жилого возраста, таких как атеросклероз, эмфизема легкого, катаракта, дегенера тивные заболевания хряща и возрастная дисфункция головного мозга и др.

Исследование влияния посттрансляционных модификаций аминокислот ных остатков белков на их структуру и механизмы функционирования остаётся малоисследованным направлением в биофизике. Прежде всего, это относится к биологически активным соединениям стереоспецифичного действия, которые могут оказывать как более, так и менее активное действие на белки организмов, подверженным возрастным изменениям.

Отдавая должное значительным успехам экспериментальной молекуляр ной геронтологии последних лет, достигнутым в данном направлении, следует отметить, что в ряде случаев функциональные нарушения, связанные с хираль ными нарушениями, можно исследовать исключительно в модельных компью терных экспериментах. В первую очередь это относится к молекулярным струк турам, присутствующим в отдельных клетках в незначительных количествах, как, например, в белковых ион-транспортных системах мембран. Тем более, ко гда изменение знака хиральности захватывает аминокислотные группы, укрытые в их гидрофильных ион-связывающих полостях. При этом принципиально важно в рамках единого численного эксперимента выполнить сравнение функций нор мальных и хирально модифицированных молекулярных структур.

Таким образом, представляется перспективным исследование структуры и механизмов функционирования ионных каналов по следующим направлениям:

1) Выбор и обоснование метода расчета энергетических профилей ионов в каналах, не требующего значительных затрат расчетного времени и выявляюще го с хорошей точностью функциональные характеристики природных и моди фицированных ионных каналов.

2) Исследование функциональных характеристик природных ионных ка налов, для которых известны их электрохимические характеристики.

3) Построение хирально модифицированных1 модельных ионных каналов, исследование их структуры и функциональных характеристик.

4) Исследование влияния неферментативной модификации остатков Asn и Asp в ионных каналах на их структуру и функциональные характеристики.

Цель и задачи исследования. Целью настоящего исследования яв лялось теоретическое исследование структурных и функциональных характери стик природных и хирально модифицированных модельных ионных каналов с инвариантной и измененной аминокислотной последовательностью.

Для достижения цели исследования решались следующие задачи:

1) Выбор и обоснование метода расчета энергетических профилей ионов в мембранных каналах, не требующего значительных затрат расчетного времени и Под хирально модифицированными ионными каналами мы понимаем каналы, в кото рых проведена замена их L-аминокислот на соответствующие D-аминокислоты.

предсказывающего с хорошей точностью функциональные характеристики ка налов.

2) Построение хирально модифицированных модельных каналов с пер вичной структурой, инвариантной природным каналам, исследование их струк турных и функциональных характеристик.

3) Разработка метода построения структуры хирально модифицированных модельных каналов с модифицированной первичной структурой и функцио нальными характеристиками, адекватными характеристикам природных кана лов.

4) Построение математической модели изменения содержания остатков iAsp и D-Asp в белках, а также оценка степени аккумуляции остатков iAsp в бел ках, время обновления которых больше времени образования остатков iAsp.

5) Исследование влияния посттрансляционных неферментативных моди фикаций остатков Asn и Asp в ионных каналах на их структурные и функцио нальные характеристики.

Объект и предмет исследования. Объектом теоретического иссле дования являлись:

1) ионные каналы клетки (потенциал-независимый калиевый канал KcsA из Streptomyces lividans, потенциал-зависимый калиевый канал KvAP из Aeropy rum pernix, потенциал-зависимый калиевый канал Kv1.2 из Rattus norvegicus, комплекс - и -субъединицы калиевого канала из Homo sapiens);

2) NR1-центр связывания NMDA-рецептора из Rattus norvegicus в ком плексе с Gly, D-Ser и D-cSer;

3) модельные D-аминокислотные каналы с модифицированной и инвари антной природной первичной структурой;

4) модельные ионные каналы, содержащие остатки D-Asp и iAsp.

Сведения о четвертичной структуре природных белков получены из Банка белковых структур2. Выбор выше указанной группы каналов обусловлен тем, что для них существуют надежные экспериментальные данные по структуре и функциональным характеристикам.

Предметом исследования являлись механизмы функционирования при родных и хирально модифицированных модельных ионных каналов.

Protein Data Bank, Brookhaven National Laboratory, USA Предпосылки и направление исследования. Экспериментально обнаруженная и теоретически изучаемая модификация отдельных аминокислот ных остатков каналов приведет не к ожидаемой инвариантности их третичной структуры, а к ее нарушению. Последнее обстоятельство является причиной из менения функциональных характеристик каналов. Для построения хирально мо дифицированных модельных каналов с природной функциональностью необхо дима модификация их первичной структуры. Появление остатков D-Asp и iAsp в ионных каналах, обусловленное старением организма или его патологическим состоянием, повлечет изменение их функциональных характеристик и в опреде ленных случаях нарушение механизмов их функционирования.

Научная новизна и значимость полученных результатов. В результате исследований впервые:

1) Теоретически обоснован и применен для расчета энергетических про филей ионов в каналах комбинированный квантово-классический метод. Уста новлено расстояние, характеризующее разделение аминокислотных остатков ионных каналов на ближние и дальние.

2) Установлено, что использование полученных комбинированных энерге тических профилей дает возможность вычислять функциональные характери стики каналов с хорошей точностью, что показано на примере ионной специ фичности калиевых каналов клетки. Предложена и теоретически обоснована мо дельная структура ионного канала в виде комплекса и субъединиц, согла сующаяся с экспериментально наблюдаемой структурой гомологичного потен циал-зависимого калиевого канала Kv 1.2.

3) Построены хирально модифицированные модельные каналы с инвари антной природной аминокислотной последовательностью, которые являются энергетически менее стабильными, чем их природные антиподы с нарушенными функциональными характеристиками.

4) Предложен метод, основанный на вариации первичной структуры и энергетическом выравнивании третичных структур, позволяющий моделировать атомную структуру хирально модифицированного модельного канала с природ ной функциональностью. Построенные из 10 D-аминокислотных остатков кана лы являются энергетически эквивалентными по полной механической энергии соответствующим природным каналам и с аналогичными функциональными ха рактеристиками.

5) Построена математическая модель, описывающая изменение содержа ния остатков iAsp и D-Asp в белках, с помощью которой показано, что аккуму ляция остатков iAsp – значимый процесс не только для очень медленно обнов ляющихся, но и для медленно обновляющихся белков, таких как ионные каналы.

6) В численном эксперименте показано, что появление остатков iAsp в ка лиевых ионных каналах приводит к уменьшению их энергетической стабильно сти, незначительному увеличению ионных токов при сохранении их калиевой избирательности. Появление остатков D-Asp в NR1-центре связывания NMDA рецептора, обусловленное патофизиологическими процессами при хронических заболеваниях пожилого возраста, приводит к появлению дополнительных али фатических аминокислотных лигандов (D-Ala, D-Leu, D-Ile и D-Pro), что не свойственно для немодифицированного NR1-центра связывания.

Методология и методы проведенного научного исследова ния. В работе использовались как традиционные методы расчета энергетиче ских профилей ионов (силовые поля молекулярной механики) и функциональ ных характеристик каналов (теория абсолютных скоростей реакций Эйринга), так и:

1) адаптированный и теоретически обоснованный нами для расчета энер гетических профилей ионов в поре канала комбинированный квантово классический метод;

2) разработанный нами метод «энергетического выравнивания» третичных структур белков как метод построения хирально модифицированных модельных каналов с измененной первичной структурой, структурно и функционально эк вивалентных соответствующим природным каналам.

Практическая значимость полученных результатов. Разрабо танные подходы позволяют изучать функциональные характеристики ионных каналов, моделировать атомные структуры хирально модифицированных мо дельных ионных каналов с функциональными характеристиками, свойственны ми природным каналам.

Теоретически установленные изменения в работе каналов, обусловленные in vivo появлением в них остатков D-Asp и iAsp в результате старения организма или при патологических состояниях, позволяют наметить пути поиска эффек тивных лекарственных препаратов, в качестве активных центров которых служат рецепторы ионных каналов.

Учитывая, что значительное число заболеваний связано с «каналопатоло гиями» - нарушениями функционирования ионных каналов или связанных с ни ми рецепторов, полученные результаты и разработанные подходы могут быть использованы при разработке стратегии и средств лечения этих заболеваний.

Полученные результаты могут применяться при исследовании биологического отклика организмов на хиральные фармпрепараты и модификацию аминокис лотных остатков каналов под воздействием антропогенных внешних факторов при решении проблем хиральной безопасности биосферы.

Полученные результаты расширяют представления о физических меха низмах происхождения хиральной асимметрии биосферы, функционирования ионных каналов и могут быть использованы в курсах лекций по биофизике, био химии и физиологии в университетах и вузах медико-биологического профиля.

Основные положения диссертации, выносимые на защиту.

1) Теоретическое обоснование комбинированного квантово-классического метода для расчета энергетических профилей, с помощью которого установлено, что в клетке с хирально модифицированными калиевыми каналами с природной первичной структурой будут нарушены многие биологические процессы, обу словленные функционированием калиевых ионных каналов. Появление остатков iAsp в калий-избирательных каналах и остатков D-Asp в NR1-центре связывания NMDA-рецептора, обусловленное посттрансляционными неферментативными модификациями аминокислотных остатков, приводит к нарушению структуры и функциональных характеристик каналов.

2) Разработанный и теоретически обоснованный нами метод энергетиче ского выравнивания структур каналов, с помощью которого были построены D аминокислотные модельные каналы с природными функциональными характе ристиками и модифицированной аминокислотной последовательностью из 10 D аминокислот: Gly, Ala, Ser, Cys, Asp, Asn, Lys, His, Phe, Pro.

Личный вклад соискателя. Выбор и обоснование научной тематики исследования, получение результатов, приведенных в диссертации, их анализ и интерпретация, как и основные публикации, сделаны при решающем участии соискателя.

Апробация работы. Результаты исследований по теме диссертации представлены на 3-й Региональной научно-технической конференции «Пробле мы экологии и экологической безопасности ЦЧ РФ» (Липецк, 1999), 7-й Между народной конференции «Математика. Компьютер. Образование» (Дубна, 2000), 3-м Всероссийском медицинском конгрессе (Ижевск, 2000), 3-м Сибирском кон грессе по прикладной и индустриальной математике (Новосибирск, 1998), 5-й Международной конференции «Физика в системе современного образования» (Санкт-Петербург, 1999), 3-й Всероссийский симпозиум «Математическое моде лирование и компьютерные технологии» (Кисловодск, 1999), 4-м Сибирском конгрессе по прикладной и индустриальной математике (Новосибирск, 2000), 5 й Республиканской электронной научной конференции «Современные проблемы информатизации» (Воронеж, 2000), Международной конференции «Математика.

Образование. Экология. Гендерные проблемы» (Воронеж, 2000), 4-й Междуна родной научно-технической конференции «Физика и радиоэлектроника в меди цине и экологии» (Владимир, 2000), Международной конференции «Биохимиче ская физика на рубеже столетий» (Москва, 2000), 2-й Региональной научной конференции по органической химии «Органическая химия на пороге третьего тысячелетия – итоги и перспективы» (Липецк, 2000), 5-й Пущинской конферен ции молодых ученых «Биология – наука 21-го века» (Пущино, 2001), 8-й Меж дународной конференции "Математика. Компьютер. Образование» (Пущино, 2001), 2-й Конференции молодых ученых России с международным участием «Фундаментальные науки и прогресс клинической медицины» (Москва, 2001), 3 й Всероссийской научной конференции «Молекулярная физика неравновесных систем» (Иваново, 2001), Международном симпозиуме «Компьютерное обеспе чение химических исследований» (Москва, 2001), 7th Scandinavian Symposium on Chemometrics (Copenhagen, 2001), XVIII Съезде физиологического общества им.

И.П. Павлова (Казань, 2001), Школе-семинаре «Введение в многомерный анализ данных (проекционные методы)» (Москва, 2001), 3-й Всероссийской школе конференции по квантовой и вычислительной химии им. В.А. Фока (Великий Новгород, 2001), Международной школе-конференции «Введение в многомер ный анализ данных (проекционные методы)» (Кострома, 2002), 13th International Congress on Molecular Biology (Toronto, 2002), 8-м Всероссийском симпозиуме «Биоинформатика и компьютерное конструирование лекарств» (Москва, 2002), 6-й Пущинской школе-конференции молодых ученых «Биология – наука 21-го века» (Пущино, 2002), 3-й Всероссийской конференции «Молекулярное модели рование» (Москва, 2003), 4th Symposium on Multivariate Data Analysis (Moscow, 2003), 3-м Съезде биофизиков России (Воронеж, 2004), 4-й Всероссийской кон ференции «Молекулярное моделирование» (Москва, 2005), Международной конференции студентов, аспирантов и молодых ученых «Ломоносов-2005» (Мо сква, 2005), Международной научной конференции «Молекулярные, мембран ные и клеточные основы функционирования биосистем» (Минск, 2006), 5-м Съезде Белорусского общественного объединения фотобиологов и биофизиков (Минск, 2006), Всероссийской научной конференции «Актуальные проблемы естественных наук и их преподавания» (Липецк, 2006), 5-й Всероссийской кон ференции «Молекулярное моделирование» (Москва, 2007), 3-м Всероссийском съезде фармакологов (Санкт-Петербург, 2007), 5-м Международном семинаре «Компьютерное моделирование электромагнитных процессов в физических, хи мических и технических системах» (Воронеж, 2007), 5-м Международном семи наре «Физико-математическое моделирование систем» (Воронеж, 2008).

Опубликованность результатов. По материалам диссертации опуб ликовано 49 печатных работ: 20 статей в рецензируемых научных журналах по списку ВАК, статьи в других журналах, изданиях и тематических сборниках – 9, в материалах конференций – 20. Список основных работ по теме диссертации приведен в конце автореферата.

Структура и объем диссертации. Диссертация включает введение, основную часть, состоящую из 4 глав, заключение, основные выводы и список цитируемой литературы. Диссертация изложена на 315 страницах, содержит рисунков и 39 таблиц.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

В первой главе рассмотрены возможности и ограничения распростра ненных методов расчета и анализа энергетических профилей ионов в мембран ных каналах. Исследованы прогностические возможности метода молекулярной механики для их расчета. Теоретически обоснован и апробирован для расчета энергетических профилей ионов в поре канала комбинированный квантово классический метод.

Движение иона в трансмембранном канале однозначно характеризуется функцией его потенциальной энергии, которая в явном или неявном виде вклю чена во все уравнения, описывающие ионный транспорт в канале (молекулярной и ланжевеновой динамики, Пуассона-Нернста-Планка). Для оценки функцио нальных характеристик канала кинетическая теория переходного состояния Эй ринга использует профиль свободной энергии Гиббса, одной из составляющих которого является потенциальная энергия иона.

При однорядном прохождении ионов через пору канала потенциальная энергия иона зависит от координаты оси канала (оси аксиальной симметрии) E = E(Z). Традиционно для расчета E = E(Z) применяются либо методы моле кулярной механики, либо квантовой химии. Методы молекулярной механики в данных расчетах не требуют значительных затрат расчетного времени, но их точность не всегда является удовлетворительной. Большинство расчетных мето дов квантовой химии лишены последнего недостатка, но требуют значительных затрат расчетного времени.

Вопрос о точности оценки энергетического профиля иона в поре канала является наиболее сложным в исследованиях ионного транспорта, что, прежде всего, обусловлено невозможностью прямого сопоставления расчетного профи ля с экспериментальным. В этом случае по полученным энергетическим профи лям осуществляется оценка функциональных характеристик канала, которые возможно сопоставить с экспериментальными значениями. К таким характери стикам в первую очередь относятся вольтамперные характеристики, ионные проводимости, отношения коэффициентов проницаемости для различных ионов.

Многообразие расчетных методов приводит к тому, что в работах, посвя щенных теоретическому исследованию ионного транспорта в каналах, часто встречается совпадение функциональных характеристик каналов, оцененных по (качественно и количественно) различным профилям иона одного и того же ка нала. Это совпадение, как правило, является следствием физически не обосно ванной калибровки энергетических профилей и параметров уравнений для рас чета функциональных характеристик каналов.

Предварительно для расчета энергетических профилей мы использовали наиболее распространенные силовые поля молекулярной механики (AMBER, CHARMM, OPLS) и проводили их количественный анализ, применяя теорию пе реходного состояния для последующего сопоставления расчетных и экспери ментальных результатов.

Свободная энергия Гиббса системы ион-вода-канал G iwc (Z ) = E ic (Z ) + E ww (Z ) + E wc (Z ) + E iw (Z ) TS iwc (Z), (1) где, в квазистатическом приближении, E ic (Z) = E ic (Z, ) – потенциальная энер гия комплекса ион-канал, – эффективная диэлектрическая постоянная, зави сящая от диаметра поры канала d, E ww (Z), E wc (Z) и E iw (Z) – потенциальная энергия комплекса вода-вода, вода-канал и ион-вода, соответственно, Siwc (Z) – энтропия.

Зависимость = (d ) рассчитывали численным решением уравнения Буза (Conway, 1981), величину E iw (Z) TS iwc (Z) – по полуэмпирическим формулам Лайо-Торрэ (Laio & Torre, 1999), включающих экспериментальные значения свободной энергии Гиббса комплексов, содержащих i молекул воды и катион в газовой фазе.

Величину E ww (Z ) + E wc (Z) с хорошей степенью точности можно считать постоянной, не зависящей от локализации иона, для определенного канала. По результатам численного моделирования методом Монте-Карло установлено, что в зависимости от положения иона на оси канала E ww (Z ) + E wc (Z) принимает по стоянное значение для определенного канала, при этом ошибка составляет не более 2%. Данный результат может быть обоснован статистической природой рассматриваемых взаимодействий и свойствами потенциалов межмолекулярного взаимодействия.

В методах силового поля E ic представляется в виде суммы энергии куло новского и вандерваальсового взаимодействия атомов канала и иона:

n A i Bi qi n E ic = + 12 6, (2) R i i =1 R i Ri i = где q i – кулоновский заряд i-го атома канала, R i – расстояние от i-го атома ка нала до иона, A i, Bi – параметры вандерваальсового взаимодействия i-го атома и иона. Практически все традиционные силовые поля, применяемые в исследо вании биомолекул, используют представление (2). Отличие наблюдается лишь в выражениях для параметров A i и B i. Силовые поля AMBER и CHARMM ис пользуют r -параметризацию:

12 r r r r A i = i + ion i ion, B i = 2 i + ion i ion, (3) 2 2 2 где ri, rion,, – параметры силового поля. Силовое поле OPLS традиционно i ion использует -параметризацию:

i ion, B i = 4( i ion ) A i = 4( i ion ) i ion, 6 (4) где i, ion,, – параметры силового поля. В случае потенциальной энер i ion гии взаимодействия двух одинаковых атомов или ионов параметр r соответст вует их вандерваальсову радиусу, – их равновесной энергии.

Важно отметить, что в подоб ных расчетах величины r,, яв ляются калибровочными параметра ми, прежде всего по соображениям «равновесной геометрии» биомолеку лярных систем. Поэтому нами иссле дована возможность замены парамет ра r кристаллографическими и ре альными ионными радиусами для возможного улучшения результатов.

В качестве тестируемого мем бранного канала нами выбран потен- Рис. 1. Поперечный срез канала KcsA циал-активируемый бактериальный калиевый канал KcsA из Streptomyces lividans. Данный выбор не является слу чайным, т.к. для данного канала существуют наиболее достоверные эксперимен тальные значения его функциональных характеристик. Канал KcsA является тет рамером. На рис. 1 представлен поперечный срез канала, демонстрирующий две из четырех его субъединиц. Пору канала можно условно разделить на три облас ти: селективный фильтр, ответственный за ионную избирательность канала (I), относительно большую центральную полость (II) и нижнюю внутреннюю пору (III).

Профили G iwc = G iwc (Z ) ионов Cs+, Rb+, K+, Na+ и Li+, с рассчитанными методом силового поля AMBER E ic (Z ) = E ic (Z, ), представлены на рис. 2.

Приведенные профили различаются во всех областях поры канала. При чем наиболее существенное различие энергетических профилей катионов на блюдается в области нижней поры канала. В нижней поре и в селективном фильтре канала KcsA существуют энергетические барьеры, причем их высоты для различных ионов находятся в следующей последовательности Cs+Rb+K+Na+Li+. В таком случае канал KcsA имеет расчетный ряд селек Cs+Rb+K+Na+Li+, тивности противоположный экспериментальному (Cs+Rb+K+Na+Li+)!

Аналогичные результаты были по лучены для профилей свободной энергии катионов, рассчитан ных методом силово го поля OPLS.

Таким образом, профили, рассчитан ные методом силового Рис. 2. Профили свободной энергии ионов в поре канала поля, во-первых, не KcsA объясняют энергети ческую предпочтительность дегидратации K+ по сравнению с другими ионами, а, во-вторых, не объясняют прохождение K+ через не реально высокий для про хождения ионов энергетический барьер (28 ккал/моль) нижней поры канала.

Для получения количественных оценок функциональных характеристик канала использовали уравнения теории абсолютных скоростей реакций Эйринга.

В таком случае профиль свободной энергии Гиббса канала может быть пред ставлен в виде последовательности M энергетических барьеров, разделенных M 1 потенциальными ямами.

Вольтамперную характеристику (ВАХ) канала J I = J I () определяли по формуле J I = k M p M 1 k 1 p1.

+ (5) Находя производную функции J I = J I () по переменной, определяли проводимость одиночного канала g I. Для объяснения ионной селективности мембранного канала мы использовали теорию Эйринга, которую количественно PB можно охарактеризовать как отношение проницаемостей для сравниваемых PA ионов А и В по формуле PB M l + i 1 l exp[G RT ] exp h h M P h =i +1 MA Ai PB A i =1 h = =, (6) PB PA MB RT ] exp l h l h i exp[G M M + P h =i +1 Bi A i =1 h = где М – масса иона. В зависимостях (5) и (6): k i+ ( k i ) – константа скорости пере хода из ямы i-1 в яму i (из ямы i в яму i-1), p i (i 0 ) – вероятность того, что ион находится в i-й яме, p 0 – вероятность того, что канал не заполнен ионами. Кон станты скорости перехода определяли по формулам k i+ = exp[ (G i G i(1) ) RT zFl i+ RT ], w k i = exp[ (G i G i( w ) ) RT + zFl i RT ], где G i (G i( w ) ) – значение энергии иона в i-м барьере (i-й яме), l i+ (l i ) – электриче ское расстояние между i-1 ямой и i-м барьером (между i-й ямой и i-м барьером), = 6.1 1012 c 1 – частотный фактор.

Рассчитанные по формуле (5) ВАХ канала в условиях симметричных мо нокатионных растворов ([I]L = [I]R = 0.4 М) представлены на рис. 3.

Расчет ме тодом AMBER по казывает сущест вование линейной зависимости меж ду током и напря жением на участке 0-60 мВ с величи ной проводимости одиночного канала для K+ 0.016 пСм, Рис. 3. Вольтамперные характеристики канала KcsA (профи для Na+ 1.3 пСм, ли свободной энергии рассчитывали методом AMBER) для Li+ 0.68 пСм, для Rb+ 0.003 пСм, для Cs+ 0.001 пСм. Данные значения проводимостей находят ся в разногласии с экспериментальными данными, согласно которым значение проводимости для различных типов калиевых каналов для K+ меняется от 4 до 270 пСм. Расчетные по формуле (6) значения отношений коэффициентов прони цаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ со ставляют 41.2, 83.1, 1, 0.2 и 0.07, соответственно. Данные значения не только противоречат экспериментальным данным (0.09, 0.07, 1.00, 0.25-0.91 и 0.18), но и предсказывают существование селективного ряда, несвойственного калие вым каналам.

Таким образом, профили свободной энергии Гиббса, полученные методом силового поля, не только не позволяют дать количественное объяснение ионной избирательности канала, но и получить правильные качественные оценки его функциональных характеристик.

Данный вывод делает настоятельно необходимым использовать метод расчета профиля свободной энергии Гиббса, не требующий значительных затрат машинного времени и сохраняющий точность квантовохимического расчета.

Этот метод может быть предложен, если учесть, что специфические квантовоме ханические эффекты, возникающие при расчете взаимодействия в системе ион канал, существенны лишь на небольших расстояниях, т.е. там, где значимо пере крывание электронных оболочек иона и атомов молекул канала.

В таком случае, возможно, использовать идеологию комбинированного квантово-классического метода (Day et al., 1996) для расчета потенциальной энергии системы ион-канал, которую можно представить в виде E ic = E ic + E ic, q c q где E ic – квантовомеханическая составляющая результирующей энергии, суще c ственная при малых расстояниях ион – атомы канала, E ic – классическая (куло новская) составляющая, существенная при больших расстояниях ион – атомы канала.

q Энергию E ic целесообразно рассчитывать одним из квантовохимических c методов для системы ион – ближние к нему аминокислоты, энергию E ic рассчи тывать в приближении точечных зарядов на атомах q i дальних аминокислот по N традиционной кулоновской схеме E ic = q i ri. Причем в качестве зарядов на c i = атомах q i можно использовать параметры электростатических взаимодействий одного из силовых полей или точечные заряды на атомах, рассчитанные кванто вохимически.

Наиболее простым в формальном отношении и одновременно дающим ра зумные результаты в некоторых случаях является метод Хоффмана или расши ренный метод Хюккеля (EHT). Формально уравнения EHT представляются в ви де:

с (Fµ Sµ ) = 0, Fµ Sµ = 0.

iµ Матричные элементы Fµ заменяются эмпирическими параметрами или аппрок симируются специально подобранными соотношениями, включающими эти па раметры. Так, диагональные матричные элементы Fµµ полагаются равными по тенциалам ионизации соответствующих валентных электронов, взятых с обрат ным знаком Fµµ = I µ. Для вычисления недиагональных матричных элементов Fµ мы использовали параметризацию Вольфсберга-Гельмгольца Fµ = 0.5K (Fµµ + F )Sµ, где К= 1.75.

Метод EHT дает адекватные результаты для молекулярных систем, имеющих равномерное распределение заряда по всем атомам или, иначе говоря, для молекул, атомы которых не сильно отличаются по электроотрицательности (обычно принимают различие не более 1.4 по шкале Полинга). Канал KcsA, как и многие другие каналы, формируется атомами C, O, N, S и H, электроотрица тельности которых составляют 2.5, 3.6, 3.0, 2.5 и 2.1 соответственно, для катио нов Li+, Na+, K+, Rb+ и Cs+ – 1.5, 3.3, 2.6, 2.4 и 1.8, соответственно (Бацанов, 2000). Таким образом, максимальное значение для атомов канала KcsA со ставляет 1.5, причем только для не связанных ковалентными связями для Li+ и карбонильных кислородов, формирующих пору канала. Следовательно, приме нение метода EHT для решения поставленных задач представляется вполне обоснованным.

Центральным вопросом расчетов по схеме E ic = E ic + E ic является вопрос q c о расстоянии между ионом и атомами поры канала, на котором возможно данное разделение. Применительно к расчету энергии взаимодействия иона и молекулы канала, целесообразно провести такой расчет в приближении точечных зарядов на атомах отдельных аминокислот, а также квантовохимически в системе ион – соответствующая аминокислота. Вид и характер рассчитанных функций потен циальной энергии E = E (r ), где r – расстояние между ионом и аминокислотой, позволит определить координату точки их расхождения. Для определения коор динат точки разделения двух функций нами проведены квантовохимические и классические расчеты зависимости энергии взаимодействия от взаимного рас стояния в системе ион–аминокислота. Подобные расчеты проведены для всех аминокислот и 5 исследуемых ионов. Наши расчеты показывают, что в зависи мости от выбора аминокислоты, координаты точки расхождения E = E (r ) со ставляют 3.2–4.2.

Таким образом, рас стояние разделения взаимодействий должно быть не меньше 4.2. Для уп рощения расчетов на ми принято R=5.

c Для расчета E ic применяли параметры электростатических Рис. 4. Профили свободной энергии KcsA (расчет методом взаимодействий (за- EHT/AMBER) ряды на атомах) сило вого поля AMBER.

Данный выбор обу словлен тем, что ре зультаты расчета мето дом AMBER хорошо сочетаются и согласу ются с результатами квантовохимического расчета распределения потенциала в канале.

Рис. 5. Вольтамперные характеристики канала KcsA Профили свобод- (энергетические профили рассчитывали методом EHT/AMBER) ной энергии Гиббса ка нала KcsA, рассчитанные методом EHT/AMBER, представлены на рис. 4.

Данные профили имеют качественно сходный вид для всех исследуемых ионов и соответствуют пятибарьерной модели канала. При этом наблюдается только количественное расхождение профилей. Величины энергетических барь еров ионов по абсолютной величине находятся в последовательности Li+Na+K+~Rb+Cs+. Учитывая, что последовательность энергетических барь еров ионов определяет последовательность ионных токов и рядов селективно сти, можно обоснованно прогнозировать согласие расчетных функциональных характеристик канала с экспериментальными.

Для проверки данного предположения нами проведен расчет функцио нальных характеристик канала по формулам (5) и (6), используя профиль, рас считанный методом EHT/AMBER. Результаты расчета ВАХ канала в условиях симметричных монокатионных растворов ([I]L = [I]R = 0.4 М) представлены на рис. 5.

Полученный результат показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ, с величиной проводимости одиночного канала для K+ 26.34 пСм, для Na+ 1.72 пСм, для Li+ 0.24 пСм, для Rb+ 19.42 пСм, для Cs+ 0.03 пСм, что соответствует экспериментально получае мым значениям. Расчетные по формуле (7) значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.009, 0.065, 1.000, 0.737 и 0.001, соответственно, что хорошо со гласуется с экспериментальными данными (0.09, 0.07, 1.00, 0.25-0.91 и 0.18).

В основу метода EHT, как и подавляющего большинства полуэмпириче ских методов, положено валентное приближение, т.е. явный учет только валент ных электронов. Невалентные электроны совместно с ядром формирует эффек тивный точечный электростатический заряд. В случае исследуемой нами моле кулярной системы ион – канал, валентное приближение, на первый взгляд, явля ется не применимым для расчета электронной структуры ионов Li+, Na+, K+, Rb+, Cs+.

Выход из отмеченного затруднения заложен в используемой нами расчет ной схеме метода EHT. Ион рассматриваются как соответствующий атом в ва лентном приближении, но при этом его ядру формально присваивается положи тельный точечный заряд +2, а не +1.

Не вызывает сомнений, что такой подход негативно отразится на оценке вандерваальсовых радиусов ионов и атомов, локализованных в области поры ка нала, и, возможно, на оценке энергетического профиля иона в канале.

Для проверки отсутствия данной ошибки нами проведен расчет энергети ческих профилей ионов в поре потенциал-независимого калиевого канала KcsA неэмпирическим квантовохимическим методом самосогласованного поля в би экспоненциальном базисе DZVP (Godbout, 1992), с последующим сравнением полученных результатов с результатами EHT-расчетов.

В результате было установлено, что функциональные характеристики ка нала KcsA, полученные анализом DZVP- и EHT-энергетических профилей ионов хорошо согласуются друг с другом и с экспериментально наблюдаемыми значе ниями (абсолютная ошибка составляет не более 4%).

Во второй главе приведены результаты исследования функциональных характеристик потенциал-зависимых калиевых каналов клетки по результатам анализа профилей свободной энергии, рассчитанных методом EHT/AMBER, ре шением уравнений теории абсолютных скоростей реакций Эйринга.

К потенциал-зависимым калиевым каналам клетки относятся каналы, спе Рис. 6. Струк тура открытого канала KvAP.

(А) Вид сверху.

(В) Вид сбоку на одну из субъединиц.

цифически активируемые деполяризацией клеточной мембраны и ассоцииро ванные с мембранной реполяризацией. Калиевые каналы играют важную роль в процессах возбудимости и проводимости мембран. Практически все каналы су персемейства потенциал-зависимых калиевых каналов являются аксиально симметричными белковыми порами, что дает возможность использовать разра ботанный и апробированный на канале KcsA алгоритм расчета функциональных характеристик каналов.

Потенциал-зависимый калиевый канал KvAP содержит стандартную K+ пору, окруженную сенсорами напряжения. Сенсоры напряжения могут менять конфигурацию за счет изменения разности потенциалов на концах мембраны и открывать пору. Они локализованы около внутриклеточной поверхности канала.

Исследователь ской группой Р. Мак кинона (2003) опреде лена атомная структу ра калиевого канала и было высказано пред положение о том, что KvAP в зависимости от направления мем бранного потенциала, Рис. 7. Профили свободной энергии открытого канала определяющего по- KvAP ложение сенсора в пространстве, может находиться в двух конформациях: от крытой – пропускаю щей ионы, и закрытой – не пропускающей ионы. При изменении разности потенциалов на концах мембраны Рис. 8. Профили свободной энергии закрытого канала KvAP подвижный сенсор напряжения занимает новое положение, что приводит к переходу канала из от крытого состояния в закрытое, и наоборот. Модель Р. Маккинона объясняет пе реход канала из одного состояния в другое, но не дает ответа на вопрос о меха низмах калиевой избирательности открытого и отсутствия таковой для закрыто го канала KvAP.

Нами проведено теоретическое исследование функциональных характери стик открытого и закрытого канала KvAP. Результаты расчета профилей свобод ной энергии для ионов Li+, Na+, K+, Rb+, Cs+ в поре открытого и закрытого кана ла представлены на рис. 7 и 8, соответственно. Профили G iwc = G iwc (Z ) в облас ти селективного фильтра и центральной полости открытого и закрытого анало гичны профилям энергии в соответствующих областях потенциал-независимого калиевого канала KcsA, что является следствием гомологичности каналов KvAP и KcsA. Существенное отличие G iwc = G iwc (Z ) каналов KvAP и KcsA наблюда ется только в области нижней поры, что обусловлено наличием дополнительных сенсоров напряжения в канале KvAP. В данной области открытого и закрытого канала KvAP появляются энергетические барьеры для всех видов ионов. Причем в закрытом канале значения энергетических барьеров больше, чем в открытом и в закрытом канале KvAP, а величина диаметра закрытого канала в области ниж ней поры меньше, чем открытого. Это различие приводит к увеличению стерических ограничений для ион-водного комплекса и, как следствие, к увели чению значения энергии данного комплекса в закрытом канале.

Таким обра зом, появление Рис. 9. ВАХ открытого канала KvAP больших, по сравне нию с открытым ка налом, энергетиче ских барьеров в об ласти нижней поры закрытого канала KvAP может быть причиной наблю даемого отсутствия ионной проводимо сти канала.

Рис. 10. ВАХ закрытого канала KvAP Для количест венного обоснования данного утверждения нами проведен анализ полученных профилей решением уравнений (5) и (6). Результаты расчета ВАХ для открытого и закрытого одиночного канала KvAP в условиях симметричных монокатионных растворов ([I]L = [I]R = 0.04 М) представлены на рис. 9 и 10, соответственно.

Данные связи показывают существование линейной зависимости между током и напряжением на участке 0–60 мВ с величиной проводимости одиночного откры того канала для K+ 12.93 пСм, для Na+ 0.32 пСм, для Li+ 0.13 пСм, для Rb+ 9. пСм, для Cs+ 0.083 пСм, что соответствует экспериментально получаемым зна чениям. Проводимости закрытого канала для K+, Na+, Li+, Rb+ и Cs+ принимают значения 0.10 пСм, 0.007 пСм, 0.002 пСм, 0.066 пСм и 0.001 пСм, соответствен но.

Таким образом, появление значительного энергетического барьера в канале KvAP при пере ходе его из открытого состояния в закрытое при изменении разности потенциалов на концах мембраны является причиной появления ма лых ионных токов, характерных для закрытого ионного канала.

Расчетные значения отно шений коэффициентов проницае- Рис. 11. Модельная структура /-канала мости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ состав ляют 0.010, 0.024, 1.000, 0.701 и 0.006, соответственно, что хорошо согласуется с экспериментальными данными.

Потенциал-зависимые калиевые каналы обычно экспрессируются вместе с дополнительными -субъединицами. В работах группы Р. Маккинона была оп ределена с разрешением 2.8 структура -субъединицы калиевого канала. При этом структура -субъединицы канала определена не была.

При построении структуры потенциал-зависимого калиевого канала в ви де комплекса - и -субъединиц (/-канал) мы исходили из совпадения осей ак сиальной симметрии - и -субъединицы. При этом -субъединица стыкуется с вогнутой поверхностью -субъединицы (Рис. 11). В качестве -субъединицы мы использовали акси ально-симметричный тетрамер потенциал независимого калие вого канала KcsA, как каноническую поро формирующую субъ единицу трансмем бранных калиевых каналов клетки.

Результаты Рис. 12А. Профили свободной энергии в области селек расчета профилей от- тивного фильтра и центральной полости -субъединицы открытого /-канала крытого канала для ионов Li+, Na+, K+, Rb+, Cs+ представлены на рис. 12. Для на глядности профили свободной энергии потенциал-зависимого калиевого /-канала представлены для трех последователь ных интервалов изме- Рис. 12Б. Профили свободной энергии в области нижней поры -субъединицы и поры -субъединицы открытого нения координаты оси /-канала Z: области селектив ного фильтра и центральной полости -субъединицы (рис. 12А), области нижней поры -субъединицы и поры -субъединицы (рис. 12Б).

Анализ энергетического профиля показывает, что основными факторами, влияющими на характер транспорта иона через канал, являются: частичная де гидратация иона при входе в пору канала и взаимодействие иона с атомными группами канала. Повышение энергии иона в результате дегидратации оказыва ется наибольшим у иона Li+ и наименьшим у иона K+, что обусловлено наи большими размерами последнего, а значит, меньшими (по модулю) величинами его взаимодействия с молекулами воды в первой гидратной оболочке.

Результаты расчета ВАХ для /-канала в условиях симметричных моно катионных растворов ([I]L = [I]R = 0.04 М) представлены на рис. 13. Данная связь показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ с величиной проводи мости одиночного ка нала для K+ 17. пСм, для Na+ 0. пСм, для Li+ 0.26 пСм, для Rb+ 16.63 пСм, для Cs+ 0.08 пСм, что соответствует экспе риментально полу чаемым значениям.

Рис. 13. ВАХ открытого /-канала Проводимость / канала для ионов ка лия несколько меньше, чем проводимость канала KcsA для соответствующих ионов, что является следствием наличия дополнительной -субъединицы в / канале. Для ионов лития и натрия наблюдается незначительное расхождение в значениях проводимости каналов / и KcsA. Расчетные значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту про ницаемости для K+ составляют 0.079, 0.015, 1.000, 0.905 и 0.005, соответственно, что хорошо согласуется с экспериментальными данными.

Таким образом, модельная молекулярная структура в виде комплекса - и -субъединиц может служить адекватной моделью потенциал-зависимого калие вого /-канала в открытом состоянии.

Для построения модели потенциал-зависимого калиевого /-канала в за крытом состоянии мы исходили из следующих предположений (рис. 11):

1) потенциал-зависимый калиевый /-канал представляет собой потенци ал-зависимый фермент с активными участками в -субъединице, локализован ными на расстоянии 30-35 от оси канала и содержащие NADP+-кофакторы;

2) при связывании фермента с молекулой субстрата происходят конфор мационные изменения в -субъединице, что в свою очередь приводит к конфор мационным изменени ям в -субъединице.

Изменение кон формации канала за счет связывания с мо лекулой субстрата мо жет быть причиной формирования закрыто го для ионов / канала. При этом воз можны два не исклю Рис. 14А. Профили свободной энергии в области селективно чающих друг друга го фильтра и центральной полости -субъединицы закрытого /-канала случая: «разбухание» молекулы канала и по ворот отдельных по лярных субъединиц в составе -субъединицы при изменении разно сти потенциалов на концах мембраны, что приводит к изменению положения отдельных субъединиц Рис. 14Б. Профили свободной энергии в области нижней по субъединицы. Учиты- ры -субъединицы и поры -субъединицы закрытого / канала вая, что эксперимен тальные данные по структуре субстрата отсутствуют, нами проведено исследо вание зависимости ионной проводимости от диаметра /-канала. Мы исследо вали зависимость J X = J X (n ), где n – отношение диаметра открытого канала к диаметру конформационно модифицированного канала с шагом 0.1.

Для расчета ионных токов, отношений коэффициентов проницаемости и проводимости канала мы использовали подход, который применяли для иссле дования открытого /-канала. При этом предполагали, что вследствие малости молекулы субстрата, его поле дает пренебрежимо малый вклад в энергетические профили.

В результате проведенных расчетов установлено, что при n = 1.8, т.е.

уменьшении диаметра почти в 2 раза, наблюдается достаточно малое значение тока ионов калия через канал: J K = 0.076 пА. В табл. 1 представлены значения + ионных токов при различных значениях n.

Таблица Ионные токи ( J X ) при различных значениях отношений ( n ) диаметров открыто го и конформационно модифицированного потенциал-зависимого калиевого / канала 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1. n 0.016 0.014 0.012 0.010 0.008 0.006 0.004 0.002 0. J Li, пА + 0.081 0.072 0.063 0.054 0.045 0.036 0.027 0.017 0. J Na, пА + 1.030 0.810 0.690 0.570 0.450 0.330 0.210 0.090 0. J K, пА + Для объяснения причин падения калиевого тока практически до значений, соизмеримых с натриевым током канала, обратимся к профилям свободной энергии канала, представленных, как и в случае открыто го канала, для трех последовательных интервалов измене ния координаты оси Z: области селектив ного фильтра и цен тральной полости субъединицы (рис.

Рис. 15. ВАХ закрытого /-канала 14A), области ниж ней поры -субъединицы и поры -субъединицы (рис. 14Б).

Существенное различие G iwc = G iwc (Z ) открытого и закрытого канала на блюдается только в области сужения поры -субъединицы. При этом высоты барьеров для различных ионов находятся в следующей последовательности K+Na+Li+. Появление столь высоких энергетических барьеров в закрытом ка нале связано не с увеличением энергии взаимодействия в системе ион-канал, а с увеличением энергии взаимодействия в системе ион-вода в результате стериче ских ограничений ион-водного комплекса. Действительно, увеличение стериче ских ограничений для ион-водного комплекса приводит к уменьшению количе ства молекул воды в частично дегидратированном комплексе и увеличению энергии ион-водного комплекса.

Результаты расчета ВАХ закрытого потенциал-зависимого калиевого / канала в условиях симметричных монокатионных растворов ([I]L = [I]R = 0.04 М) представлены на рис. 15. Данная связь показывает сущест вование линейной зависимости между током и напряжением на участке 0–60 мВ с малыми величинами проводимости одиночного канала: для K+ 1.27 пСм, для Na+ 0.20 пСм, для Li+ 0.016 пСм, для Rb+ 1.05 пСм, для Cs+ 0.005 пСм, что соот ветствует закрытому состоянию потенциал-зависимого калиевого канала.

Таким образом, переход потенциал-зависимого калиевого /-канала из открытого в закрытое состояние осуществляется при связывании молекулы суб страта с -субъединицей канала, сопровождающийся конформационной пере стройкой канала при изменении разности потенциалов на концах мембраны.

В результате предложенная и теоретически обоснованная нами модельная структура /-канала хорошо согласуется с экспериментально наблюдаемой структурой гомологичного канала Kv 1.2.

Подобный подход мы использовали и для исследования потенциал зависимого калиевого канала Kv1.2 типа Shaker из Rattus norvegicus, для которо го получили хорошее согласие экспериментальных и расчетных функциональ ных характеристик.

В третьей главе проведено исследование структуры и функциональных характеристик хирально модифицированных модельных каналов с инвариантной и модифицированной природной аминокислотной последовательностью.

Долгое время считалось, что хиральная чистота биосферы носит абсолют ный характер, т.е. биологически важные реакции в живых организмах происхо дят только с участием L-аминокислот и D-сахаров.

Однако хиральные антиподы природных органических соединений играют существенную роль в биохимии и физиологии всех организмов – от бактерий до млекопитающих. Например, D-Ser является нейромодулятором, связывающимся с центром связывания NMDA-рецептора нервных клеток млекопитающих. Ком поненты клеточной стенки бактерий зачастую содержат L-углеводы и остатки D аминокислот. Данные остатки также содержат некоторые пептидные антибиоти ки. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, в не которых случаях в значительных концентрациях. Однако все, что относится к рибосомальному синтезу полипептидов, характеризуется абсолютной хиральной чистотой: полипептиды содержат остатки только L-аминокислот, а нуклеиновые кислоты – только D-сахара.

Вопрос о биологической роли гомохиральности этих важнейших биопо лимеров относительно прост. Так, гомохиральность белков и нуклеиновых ки слот определяет их стереоспецифичность – необходимое условие матричного синтеза, а также обусловливает стабильность их структур, обеспечивающих их функционирование. Но, несмотря на значительные успехи, достигнутые в этой области, биологические основы того, что белки-ферменты и нуклеиновые кисло ты имеют строго определенный знак хиральности, остаются неизвестными.

Нам представляется, что ответ на последний вопрос необходимо искать, в частности, в исследовании влияния (LD)-преобразования аминокислотных ос татков на структурные и функциональные характеристики ионных каналов.

Возможны два способа построения пространственной структуры каналов из D-аминокислот.

1. Построение модельного канала полным зеркальным отражением при родного канала. В этом случае получаем канал из D-аминокислот с преобразова нием торсионных углов всех аминокислот вида - и -. Следствием этого будет, например, преобразование всех правых -спиралей в левые. Не вызывает сомнений, что «отраженный» канал ни чем, кроме направления вращения спиралей и направления скрученности -структур из-за скрученности отдельных -тяжей, не будет отличаться от природного. Неизменной будет и потенциальная энергия молекулы канала и его функциональные характеристики. Поэтому по строение и исследование функционирования таких хирально модифицирован ных каналов не представляет интереса.

2. Построение модельного канала заменой всех L-аминокислот на D аминокислоты при сохранении природной вторичной структуры канала. Такая замена эквивалентна замене бокового радикала R на H-атом, стоящий при углероде аминокислоты. В результате, при сохранении природной вторичной структуры в молекуле модельного канала появляются значительные стерические напряжения, снятие которых приведет к изменению его третичной и четвертич ной структуры, а также функциональных характеристик. Поэтому хирально мо дифицированные каналы, полученные по данной схеме, представляют наиболь ший интерес в исследовании их структуры и функциональных характеристик.

Следует отметить, что появление стерических напряжений является вполне обоснованным, т.к. углы и модифицированных аминокислот в основном по падают в запрещенные области карты Рамачандрана.

Стерические напряжения в канале после замены L-аминокислот на D аминокислоты снимали методами молекулярной динамики в интервале 10 пс при шаге 0.001 пс. При расчете функции потенциальной энергии молекулы мы ис пользовали представление и параметризацию силового поля AMBER. Данный выбор обоснован тем, что силовое поле AMBER было параметризовано для ис следования структуры и динамики белков и нуклеиновых кислот. Для исследо вания функциональных характеристик хирально модифицированных модельных каналов использовали подход, применявшийся нами для исследования природ ных калиевых каналов.

D-аминокислотные ионные каналы с инвариантной первичной структурой.

Результаты численного моделирования молекулярной динамики каналов показывают, что зависимости потенциальной энергии молекулы канала от вре мени характеризуются наличием множества локальных минимумов, причем по нашим наблюдениям, каждый из них соответствует пору-формирующей кон формации молекулы как природного, так и хирально модифицированного кана ла.

В табл. 2 представлены результаты исследований структуры и функцио нальных характеристик хирально модифицированных модельных каналов: от ношение наиболее глубокого локального минимума природного канала к соот ветствующему минимуму его хирально модифицированного изомера ( U L D ), от ношение среднего радиуса поры D-аминокислотного канала (D-канала) к радиу су поры его природного аналога ( R D L ), ионные проводимости ( g I ) и токи ( J I ) D-канала при =60мВ.

Таблица Структурные и функциональные характеристики D-аминокислотных каналов с инвариантной первичной структурой UL D RD L g I, пСм J I, пА Канал + + Li 18.533 Li 0. Na+ Na+ 146.366 0. K+ K+ D-KcsA 0.99 1.4 459.700 1. Rb+ Rb+ 401.883 1. Cs+ Cs+ 3.850 0. Li+ Li+ 3.683 0. Na+ Na+ 31.267 1. K+ K+ D-KvAPo 1.01 1.2 405.305 24. Rb+ Rb+ 318.900 19. Cs+ Cs+ 3.483 0. Li+ Li+ 0.216 0. Na+ Na+ 0.866 0. K+ K+ D-KvAPc 1.01 1.2 12.850 0. Rb+ Rb+ 5.766 0. Cs+ Cs+ 0.716 0. Li+ Li+ 2.717 0. Na+ Na+ 7.200 0. K+ K+ D-/o 1.012 1.05 174.267 10. Rb+ Rb+ 164.083 9. Cs+ Cs+ 2.533 0. Li+ Li+ 0.383 0. Na+ Na+ 2.600 0. K+ K+ D-/c 1.011 1.05 13.900 0. Rb+ Rb+ 12.800 0. Cs+ Cs+ 0.150 0. Li+ Li+ 2.717 0. Na+ Na+ 5.667 0. K+ K+ D-Kv1.2o 1.001 1.07 99.783 5. Rb+ Rb+ 79.083 4. Cs+ Cs+ 1.583 0. Li+ Li+ 2.717 0. Na+ Na+ 5.667 0. K+ K+ D-Kv1.2c 1.002 1.07 99.783 0. Rb+ Rb+ 79.083 0. Cs+ Cs+ 1.583 0. Представленные в табл. 2 теоретические результаты наглядно демонстри руют, что полная потенциальная энергия хирально модифицированных и соот ветствующих природных каналов совпадает, а изомеризация аминокислот кана лов приводит к увеличению радиуса поры. Кроме того, хирально модифициро ванный изомер канала KcsA не является калий-избирательным с большими зна чениями ионных токов, что характерно и для открытых D-каналов KvAP, / и Kv1.2. Хирально модифицированные изомеры закрытых каналов KvAP, / и Kv1.2 обладают проводимостями и токами, практически совпадающими с тако выми для их природных изомеров. Этот результат позволяет считать, что хи рально модифицированные изомеры закрытых потенциал-зависимых каналов на самом деле является не закрытыми, а открытыми потенциал-зависимыми калие выми каналами.

Подобные же исследования нами проведены для NR1-центра связывания NMDA-рецептора в комплексе с Gly, D-Ser и D-cSer. В результате численного моделирования молекулярной динамики было установлено, что комплекс при родного NR1-центра связывания NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс природного NR1-центра связыва ния NMDA-рецептора и неприродных L-лигандов. Напротив, комплекс хирально модифицированного NR1-центра связывания NMDA-рецептора и неприродных L-лигандов энергетически почти эквивалентен комплексу природного NR1 центра связывания NMDA-рецептора и природного D-лиганда.

Возможно, эта функциональная, а не энергетическая неэквивалентность стереоизомеров пептидов могла играть важную роль в возникновении гомохи ральности строго определенного знака белков на уровне отбора наиболее совер шенных структур в ходе эволюции.

D-аминокислотные ионные каналы с модифицированной первичной структурой.

Замена всех L-аминокислот природного канала на соответствующие D аминокислоты при сохранении природной первичной и вторичной структуры приводит к изменению основных функциональных характеристик и потери его калиевой избирательности. Такие результаты делают настоятельно необходи мым рассмотреть возможность изменения природной первичной структуры ка налов до получения третичной структуры хирально модифицированного мо дельного канала с природными функциональными характеристиками.

Для построения хирально модифицированных модельных каналов с при родными функциональными характеристиками нами предложен метод «энерге тического выравнивания» третичных структур каналов с различными аминокис лотными последовательностями.

В основу метода положены следующие предположения:

1) структурно гомологичные L- и D-аминокислотные каналы имеют близ кие распределения энергий аминокислотных остатков;

2) функционально гомологичные L- и D-аминокислотные каналы содер жат соответствую щие аминокислот ные остатки, при надлежащие опреде ленной родственной группе аминокислот.

Метод вклю чает следующую по следовательность действий:

1) для третич ной структуры при- Рис. 16. Распределение абсолютных значений разности энергий аминокислотных остатков природного и неоптими родного канала рас зированного хирально модифицированного канала считываются энер гии взаимодействия каждой аминокисло ты с остальными аминокислотами и строится распреде ление энергии взаи модействия всех L аминокислот канала;

2) подобное распределение энер- Рис. 17. Распределение абсолютных значений разности энергий аминокислотных остатков природного и хирально гии аминокислот модифицированного канала с модифицированной амино рассчитывается для кислотной последовательностью, полученной энергетиче ским выравниванием структур соответствующего хирально модифицированного модельного канала с природной первичной струк турой без оптимизации его геометрии;

3) сравнением полученных распределений энергии L- и D-аминокислот, определяются D-аминокислоты, для которых разность соответствующих энергий принимает наибольшие значение;

4) наиболее напряженные D-аминокислоты заменяют D-аминокислотами, для которых разность энергий взаимодействия будет минимальной;

5) в полученном хирально модифицированном канале с модифицирован ной первичной структурой методами молекулярной динамики снимают остаточ ные стерические напряжения.

Замену L- на D-аминокислоты проводили исключительно в пределах род ственных групп аминокислотных остатков: с алифатическими боковыми цепями;

с боковыми цепями, содержащими гидроксильную группу;

с боковыми цепями, содержащими атомы серы;

с боковыми цепями, содержащими кислые группы или их амиды;

с боковыми цепями, содержащими основные группы;

содержащие ароматические кольца и иминокислоты.

В результате энергетического выравнивания получается хирально моди фицированный модельный канал энергия, геометрия поры, энергетические про фили и функциональные характеристики которого пренебрежимо мало отлича ются от таковых соответствующего природного канала.

Распределение абсолютных значений разности энергий аминокислотных остатков природного канала KcsA и неоптимизированного его хирально моди фицированного изомера представлено на рис. 16. Диаграмма показывает, что в некоторых аминокислотных остатках существуют значительные стерические на пряжения, достигающие 88000 ккал/моль. Очевидно, что данное значение энер гии, как и многие другие значения энергии D-аминокислот, значительно превы шает среднее значение энергии пептидной связи, что определяет принципиаль ную невозможность существования такого полипептида и необходимость ис пользования энергетического выравнивания для снятия значительных стериче ских напряжений в полипептиде.

Диаграмма, представленная на рис. 17, показывает распределение абсо лютных значений разности энергий L-аминокислотных остатков природного и хирально модифицированного модельного канала с модифицированной амино кислотной последовательностью, полученной энергетическим выравниванием структур. В этом случае замена значительно напряженных аминокислотных ос татков в неоптимизированном хирально модифицированном изомере приводит к появлению ненапряженной, по сравнению с природной структурой, третичной структуры хирально модифицированного канала KcsA. Ниже представлена ами нокислотная последовательность хирально модифицированного AATGRGGGAGSVIGAAGAGAGCGGAGIADGGAVGADVASSAKGAHHAGASASSAGYGDGASGSI HGHCVGVVAGAAGISSVGAVSAAGASHFVGREQ и природного канала KcsA.

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWG RCVAVVVMVAGITSFGLVTAALATWFVGREQ Подобный подход нами использовался для построения молекулярных структур хирально модифицированных изомеров каналов KvAP, /, Kv1.2 и NR1 активного центра NMDA-рецептора. В табл. 3 представлены результаты ис следований структуры и функциональных характеристик, полученных энергети ческим выравниванием хирально модифицированных каналов.

Таблица Структурные и функциональные характеристики D-аминокислотных каналов с модифицированной первичной структурой UL D RD L g I, пСм J I, пА Канал + + Li 0.23 Li 0. Na+ Na+ 1.65 0. K+ K+ D-KcsA 0.857 1.07 26.37 1. Rb+ Rb+ 18.88 1. Cs+ Cs+ 0.02 0. Li+ Li+ 0.083 0. Na+ Na+ 0.035 0. K+ K+ D-KvAPo 0.923 1.05 11.68 0. Rb+ Rb+ 10.03 0. Cs+ Cs+ 0.15 0. Li+ Li+ 0.005 0. Na+ Na+ 0.003 0. K+ K+ D-KvAPc 0.934 1.04 0.093 0. Rb+ Rb+ 0.065 0. Cs+ Cs+ 0.002 0. Li+ Li+ 0.005 0. Na+ Na+ 0.53 0. K+ K+ D-/o 0.871 1.02 1.1 1. Rb+ Rb+ 0.98 1. Cs+ Cs+ 0.01 0. Li+ Li+ 0.05 0. D-/c 0.869 1. Na+ Na+ 0.053 0. K+ K+ 1.1 0. Rb+ Rb+ 0.98 0. Cs+ Cs+ 0.012 0. Li+ Li+ 0.32 0. Na+ Na+ 0.56 0. K+ K+ D-Kv1.2o 0.901 1.01 10.75 0. Rb+ Rb+ 6.63 0. Cs+ Cs+ 0.02 0. Li+ Li+ 0.002 0. Na+ Na+ 0.02 0. K+ K+ D-Kv1.2c 0.889 1.01 0.06 0. Rb+ Rb+ 0.03 0. Cs+ Cs+ 0.002 0. Представленные в табл. 3 результаты позволяют утверждать, что радиус поры и функциональные характеристики хирально модифицированных каналов практически совпадают с таковыми для соответствующих природных каналов.

При этом хирально модифицированные каналы энергетически более стабильны, чем соответствующие природные каналы (хирально модифицированные каналы примерно в 1.2 раз энергетически более стабильны, чем существующие природ ные каналы).

В отличие от калиевых каналов, в результате подобных исследований структуры хирально модифицированного NR1-центра связывания NMDA рецептора нами установлено, что комплекс природного NR1-центра связывания NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс хирально модифицированного NR1-центра связывания NMDA рецептора и неприродных L-энантиомеров лиганда. Так для лигандов Gly, Ser и cSer разность энергий комплексов составляет 134.18 ккал/моль, 148.29 ккал/моль и 145.04 ккал/моль, соответственно.

Молекулярный комплекс хирально модифицированного NR1-центра свя зывания NMDA-рецептора и природных D-лигандов энергетически менее стаби лен, чем комплекс природного NR1-центра связывания NMDA-рецептора и при родного D-лиганда. Для лигандов Gly, Ser и cSer разность энергий комплексов составляет 1457.05 ккал/моль, 1443.05 ккал/моль и 1447.99 ккал/моль, соответст венно. Данный результат существенно отличается от результата, полученного для хирально модифицированных калиевых каналов с модельной первичной структурой. Нам представляется вполне очевидным, что для получения значения энергии комплекса хирально модифицированного центра связывания NMDA рецептора с L-лигандом согласующейся с энергией комплекса природного цен тра связывания NMDA-рецептора и природного лиганда, необходимо, кроме мо дификации первичной структуры рецептора, использование другого лиганда.

Данное обстоятельство обусловлено тем, что, в отличие от иона, лиганд центра связывания NMDA-рецептора является более сложной (многоцентровой) моле кулярной структурой.

Последний результат, возможно, означает, что в биосфере, которая ис пользует D-аминокислоты и L-сахара, совершенно другими были бы клеточные рецепторы и их субстраты. Следовательно, совершенно другой была бы и вся биохимия клеточных процессов, связанных с рецепцией.

Для исключения возможных артефактов метода энергетического выравни вания нами проверены коммутативность операций зеркального отражения и ми нимизации полной энергии молекулы. Проведено решение обратной задачи по строения методом энергетического выравнивания структуры природного канала из структуры хирально модифицированного модельного канала с природными функциональными характеристиками. В результате функциональные характери стики модельного и природного канала достаточно хорошо согласуются друг с другом (абсолютная ошибка составляет не более 3%), а метод энергетического выравнивания можно считать надежным методом построения хирально модифи цированных каналов с природными функциональными характеристиками.

Подобная коммутативность нами проверена также для грамицидинового канала – одного из наиболее хорошо изученных каналов, сформированным пеп тидным антибиотиком грамицидином А. Грамицидин синтезируется в ходе S матричного синтеза, который широко распространен у бактерий. При S-матричном синтезе пептидов, возникшем на гораздо более поздних стадиях эволюции, чем синтез рибосомальный, могут использоваться нестандартные аминокислоты, в том числе и D-аминокислоты. В результате проведенного рас чета установлено, что расхождение отношений коэффициентов проницаемостей хирально модифицированного и природного грамицидинового канала составляет не более 2%, что подтверждает выполнение коммутативности рассмотренных операций.

Нам представляется, что в ходе предбиологической эволюции могли сформироваться белки, построенные из D-аминокислот, но с первичной структу рой, отличной от существующей природной структуры белков. Не вызывает со мнений, что в этом случае для обеспечения матричного синтеза D аминокислотных белков нуклеиновые кислоты будут построены из L-сахаров.

Следует отметить, что существование биосферы, которая использует D аминокислоты и L-сахара, согласуется с выводами традиционной теории спон танного нарушения зеркальной симметрии и существуют достоверные данные о взаимодействии аминокислот и нуклеиновых кислот различной хиральности.

Если сравнить D-аминокислотные последовательности модельных кана лов, сохранивших природную функциональность, то несложно установить вари анты преобразований L-аминокислот в D-аминокислоты (рис. 18). Причем это единственная схема преобразований, позволяющая получать хирально модифи цированные модельные каналы с природной функциональностью.

GLGD ALAD SLSD CLCD DLDD NLND KLKD HLHD FLFD PLPD LLGD VLAD TLSD МLCD ELDD QLND RLKD WLHD YLFD ILGD Рис. 18. Преобразование L-аминокислот в D-аминокислоты сохраняющее природную функциональность ионных каналов Таким образом, любой D-аминокислотный канал может быть построен в виде комбинации 10 аминокислот (G, A, S, C, D, N, K, H, F, P) и, соответствен но, для их синтеза вполне достаточной была бы дублетная таблица D аминокислотного генетического кода, кодирующая не более 15 аминокислот.

Нам представляется, что именно ионные каналы как молекулярные посредники формирования ионной асимметрии клеток – необходимого условия их стабиль ности, возможно, являются наиболее ранними белками.

Возможно, на более поздних этапах эволюции D-аминокислотных белков, в процессе увеличения разнообразия структур и функций белков, в матричный синтез могли бы быть включены другие D-аминокислоты, что привело бы к ус ложнению генетического кода до триплетного и увеличению разнообразия структур и функций белков.

Вопрос о возможном эволюционном возникновении большего разнообра зия используемых в биосинтезе аминокислот может быть решен на основе тео рии коэволюции (Wong,1975). При этом полный анализ взаимодействия факто ров эволюции, которое могло бы привести к переходу на триплетный код и к ис пользованию набора из 20 D-аминокислот в рибосомальном синтезе белков, вы ходит за рамки настоящей работы.

В четвертой главе рассмотрены структурные и функциональные ха рактеристики ионных каналов, содержащие остатки D-Asp и iAsp появление ко торых может быть обусловлено посттрансляционными неферментативными мо дификациями остатков L-Asn и L-Asp in vivo.

Вплоть до 70-х годов прошлого века считалось, что все белки живых орга низмов состоят из L-аминокислотных остатков. Однако экспериментально было установлено, что со временем наблюдается увеличение содержания остатков D Asp и iAsp в различных тканях организма человека и животных. Позднее было установлено, что данные аминокислотные остатки являются продуктами реак ции посттрансляционной неферментативной модификации остатков L-Asp и L Asn в белках.

Отмечено появление остатков D-Asp в белках больных болезнью Альц геймера, Паркинсона, при склеротических изменениях в сердечно-сосудистой системе, при глазной катаракте и т.д., а также в очень медленно обновляющихся белках в норме, таких как коллаген, дентин и др.

Если появление остатков D-Asp характерно для очень медленно обнов ляющихся белков в норме и белков организма в патологическом состоянии, то появление iAsp характерно даже для медленно обновляющихся белков. Послед нее связано с тем, что время жизни медленно обновляющихся белков превышает время образования остатков iAsp в этих белках. Образование D-Asp более дли тельный процесс при нормальных физиологических условиях.

Относительная частота содержания остатков D-Asp и (или) iAsp в белках с временем жизни T0 является решением дифференциального уравнения 1 x ( D )iAsp Xxx x iAsp Xxx = v ( D )iAsp Xxx, (7) & C C Asx Xxx Asx с периодическими начальными условиями x ( D )iAspXxx (nT0 ) = 0, n = 0, 1, 2, 3, …., характеризующими процесс обновления и деградации белков.

Здесь x ( D )iAsp Xxx = X ( D )iAsp Xxx C Asx – отношение количества остатков D-Asp и (или) iAsp к общему количеству остатков Asx3, C AsxXxx – количество остатков Asx в фрагментах Asx-Xxx аминокислотной последовательности, v ( D )iAspXxx – скорость образования остатков D-Asp и iAsp из остатков Asx в зависимости от следующего за Asx остатка Xxx аминокислотной последовательности, n – опре деляет периодичность процесса обновления белка.

Относительная частота содержания остатков (D)-iAsp в одиночном белке, определяемая с помощью решения (7), имеет следующий вид v x ( D )iAsp = c Asx Xxx c Asx Xxx exp ( D )iAsp Xxx (t nT0 ). (8) C Asx Xxx Xxx Xxx В зависимости (8) c Asx Xxx = C Asx Xxx C Asx – относительная частота содер жания фрагментов Asx-Xxx в аминокислотной последовательности белков.

Экспериментальному и теоретическому исследованию содержания остат ков D-Asp и их влияния на функциональные характеристики очень медленно об новляющихся белков посвящено большое количество работ (см. обзор Ritz-Time et al., 2002). Напротив, практически отсутствуют работы посвященные исследо ванию содержания остатков iAsp и их влиянию на функциональные характери стики белков с T0 1 v, что характерно для большинства медленно обновляю щихся белков, таких как ионные каналы.

В последнем случае представляет несомненный интерес исследование за висимости среднего, по совокупности белков организма, значения x iAsp от t для медленно обновляющихся белков c T0 = const и белков с T0 = f (t ) имеют сле дующий вид (рис. 19 и 20). Появление T0 = f (t ) обусловлено экспериментально установленным увеличением времени жизни белков с возрастом (Ward, 2000).

Для построения x iAsp = x iAsp (t ) с использованием (8) величины c Asn Xxx опре деляли по результатам статистического анализа 17704 Asn-содержащих амино кислотных последовательностей из Банка белковых структур, величины v iAsp Xxx – по результатам регрессионного анализа, в котором в качестве независимой пе ременной использовали разность полных энергий дипептидов iAsp-Xxx и Asn Xxx.

Для удобства, под Asx понимается один из остатков Asp или Asn Зависимость, представленная на рис. 19 показывает, что x iAsp имеет по стоянное значение на протяжении жизни организма и составляет примерно 12%.

Следовательно, даже в медленно обновляющихся белках возможно отличное от нуля содержание iAsp на протяжении жизни организма и это содержание не ме няется с возрастом. График, представленный на рис. 20 наглядно демонстрирует, что учет T0 = T0 (t ) в выражении (8) приводит возрастающей зависимости x iAsp = x iAsp (t ), даже для медленно обновляющихся белков.

Таким образом, пред ставляет несо мненный ин терес исследо вание струк турных и функциональ ных характе ристик калий избирательных Рис. 19. Зависимость x iAsp = x iAsp (t ) для белков с T0 = const каналов, в ко торых прове дена замена остатков Asn на iAsp. Кроме того, важность таких иссле дований обу словлена су ществованием эксперимен тально уста Рис. 20. Зависимость x iAsp = x iAsp (t ) для белков с T0 = f (t ) новленных (Погорелов и др., 2006) возрастных изменений содержания Na+ и K+ в мышечной клетке серд ца, которые сопряжены с нарушениями в работе ионных каналов.



Pages:   || 2 |
 




 
2013 www.netess.ru - «Бесплатная библиотека авторефератов кандидатских и докторских диссертаций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.